PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Tp57577_TGAC_v2_mRNA15177

Organism

Trifolium pratense

Taxonomic ID

57577

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium

Family

M-type_MADS

Protein Properties

Length: 77aa MW: 8842.5 Da PI: 10.6319

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Tp57577_TGAC_v2_mRNA15177	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	103.7	6.3e-33	9	58	1	50
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 krienk+nrqvtfskRrng+lKKA+ELSvLCdaeva+iifss+gklye+ Tp57577_TGAC_v2_mRNA15177 9 KRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFG 58 79**********************************************95 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	4.0E-42	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	33.613	1	61	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	3.53E-31	2	66	IPR002100	Transcription factor, MADS-box
CDD	cd00265	1.35E-38	2	59	No hit	No description
PRINTS	PR00404	6.3E-34	3	23	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	2.3E-28	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	6.3E-34	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	6.3E-34	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 77 aa Download sequence Send to blast
MGRGRIELKR IENKINRQVT FSKRRNGLLK KAYELSVLCD AEVALIIFSS RGKLYEFGSV 60 GYFFFLSLIY KVSIFL*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5f28_A	3e-21	1	61	1	61	MEF2C
5f28_B	3e-21	1	61	1	61	MEF2C
5f28_C	3e-21	1	61	1	61	MEF2C
5f28_D	3e-21	1	61	1	61	MEF2C
6byy_A	3e-21	1	61	1	61	MEF2 CHIMERA
6byy_B	3e-21	1	61	1	61	MEF2 CHIMERA
6byy_C	3e-21	1	61	1	61	MEF2 CHIMERA
6byy_D	3e-21	1	61	1	61	MEF2 CHIMERA
6bz1_A	3e-21	1	61	1	61	MEF2 CHIMERA
6bz1_B	3e-21	1	61	1	61	MEF2 CHIMERA
6bz1_C	3e-21	1	61	1	61	MEF2 CHIMERA
6bz1_D	3e-21	1	61	1	61	MEF2 CHIMERA
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in flower development. {ECO:0000250\|UniProtKB:Q0HA25}.
UniProt	Probable transcription factor. Regulates floral organ identity and floral meristem determinacy. May be involved in the control of flowering time. {ECO:0000269\|PubMed:19820190, ECO:0000269\|Ref.8}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Tp57577_TGAC_v2_mRNA15177

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AY884289	5e-57	AY884289.1 Pisum sativum MADS box protein M5 mRNA, partial cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_012475143.1	2e-36	PREDICTED: agamous-like MADS-box protein AGL6 isoform X3
Refseq	XP_016682182.1	2e-36	PREDICTED: agamous-like MADS-box protein AGL6 isoform X1
Refseq	XP_017625221.1	2e-36	PREDICTED: agamous-like MADS-box protein AGL6 isoform X1
Refseq	XP_017625222.1	2e-36	PREDICTED: agamous-like MADS-box protein AGL6 isoform X2
Refseq	XP_017625224.1	2e-36	PREDICTED: agamous-like MADS-box protein AGL6 isoform X4
Refseq	XP_017625225.1	2e-36	PREDICTED: agamous-like MADS-box protein AGL6 isoform X5
Swissprot	Q6EU39	4e-36	MADS6_ORYSJ; MADS-box transcription factor 6
Swissprot	Q8LLR1	3e-36	MADS3_VITVI; Agamous-like MADS-box protein MADS3
TrEMBL	A0A178VQY2	5e-36	A0A178VQY2_ARATH; Uncharacterized protein
TrEMBL	A0A426ZY62	5e-36	A0A426ZY62_ENSVE; Uncharacterized protein (Fragment)
STRING	BRADI3G51800.1	8e-35	(Brachypodium distachyon)
STRING	Pavir.Aa00924.1.p	6e-35	(Panicum virgatum)
STRING	Pavir.Ab02707.1.p	6e-35	(Panicum virgatum)
STRING	MLOC_52944.1	7e-35	(Hordeum vulgare)
STRING	ORGLA02G0240800.1	5e-36	(Oryza glaberrima)
STRING	Si018160m	6e-35	(Setaria italica)
STRING	Sb04g031750.1	6e-35	(Sorghum bicolor)
STRING	Traes_6BL_7C6B17284.2	7e-35	(Triticum aestivum)
STRING	GRMZM2G160565_P01	6e-35	(Zea mays)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF119	33	360

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G45650.1	4e-38	AGAMOUS-like 6

Link Out ? help Back to Top
Phytozome	Tp57577_TGAC_v2_mRNA15177

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Jaillon O, et al. The grapevine genome sequence suggests ancestral hexaploidization in major angiosperm phyla. Nature, 2007. 449(7161): p. 463-7 [PMID:17721507] Díaz-Riquelme J,Lijavetzky D,Martínez-Zapater JM,Carmona MJ Genome-wide analysis of MIKCC-type MADS box genes in grapevine. Plant Physiol., 2009. 149(1): p. 354-69 [PMID:18997115] Li H, et al. The AGL6-like gene OsMADS6 regulates floral organ and meristem identities in rice. Cell Res., 2010. 20(3): p. 299-313 [PMID:20038961] Zhang J,Nallamilli BR,Mujahid H,Peng Z OsMADS6 plays an essential role in endosperm nutrient accumulation and is subject to epigenetic regulation in rice (Oryza sativa). Plant J., 2010. 64(4): p. 604-17 [PMID:20822505] Seok HY, et al. Rice ternary MADS protein complexes containing class B MADS heterodimer. Biochem. Biophys. Res. Commun., 2010. 401(4): p. 598-604 [PMID:20888318] Li H, et al. Rice MADS6 interacts with the floral homeotic genes SUPERWOMAN1, MADS3, MADS58, MADS13, and DROOPING LEAF in specifying floral organ identities and meristem fate. Plant Cell, 2011. 23(7): p. 2536-52 [PMID:21784949] Yadav SR,Khanday I,Majhi BB,Veluthambi K,Vijayraghavan U Auxin-responsive OsMGH3, a common downstream target of OsMADS1 and OsMADS6, controls rice floret fertility. Plant Cell Physiol., 2011. 52(12): p. 2123-35 [PMID:22016342] Duan Y, et al. Characterization of Osmads6-5, a null allele, reveals that OsMADS6 is a critical regulator for early flower development in rice (Oryza sativa L.). Plant Mol. Biol., 2012. 80(4-5): p. 429-42 [PMID:22933119] Conrad LJ, et al. The polycomb group gene EMF2B is essential for maintenance of floral meristem determinacy in rice. Plant J., 2014. 80(5): p. 883-94 [PMID:25279942] Zhang J, et al. Down-regulation of a LBD-like gene, OsIG1, leads to occurrence of unusual double ovules and developmental abnormalities of various floral organs and megagametophyte in rice. J. Exp. Bot., 2015. 66(1): p. 99-112 [PMID:25324400] Bai X, et al. Regulatory role of FZP in the determination of panicle branching and spikelet formation in rice. Sci Rep, 2016. 6: p. 19022 [PMID:26744119] Grimplet J,Martínez-Zapater JM,Carmona MJ Structural and functional annotation of the MADS-box transcription factor family in grapevine. BMC Genomics, 2016. 17: p. 80 [PMID:26818751] Zhang B, et al. A High Temperature-Dependent Mitochondrial Lipase EXTRA GLUME1 Promotes Floral Phenotypic Robustness against Temperature Fluctuation in Rice (Oryza sativa L.). PLoS Genet., 2016. 12(7): p. e1006152 [PMID:27367609]