PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Tp57577_TGAC_v2_mRNA19445

Organism

Trifolium pratense

Taxonomic ID

57577

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium

Family

MYB_related

Protein Properties

Length: 101aa MW: 11637.2 Da PI: 9.9837

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Tp57577_TGAC_v2_mRNA19445	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	24.4	6.6e-08	2	37	12	47
HHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 12 lvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 ++ + k++ g Wk+I+r+ k++++ q+ s+ qky Tp57577_TGAC_v2_mRNA19445 2 FLSGLKKYKEGEWKLISRYYVKTKSPTQVASHAQKY 37 78899******************************9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	11.79	1	42	IPR017930	Myb domain
SuperFamily	SSF46689	1.79E-8	2	42	IPR009057	Homeodomain-like
CDD	cd00167	3.53E-4	2	38	No hit	No description
TIGRFAMs	TIGR01557	3.3E-8	2	41	IPR006447	Myb domain, plants

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 101 aa Download sequence Send to blast
SFLSGLKKYK EGEWKLISRY YVKTKSPTQV ASHAQKYFLR KNEANKHKER KRSSIHDITL 60 EDSNSAPTPI DRNCVLPPGV GSLHQSEGMY YFPSNSMQDQ M

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that coordinates abscisic acid (ABA) biosynthesis and signaling-related genes via binding to the specific promoter motif 5'-(A/T)AACCAT-3'. Represses ABA-mediated salt (e.g. NaCl and KCl) stress tolerance. Regulates leaf shape and promotes vegetative growth. {ECO:0000269\|PubMed:26243618}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Tp57577_TGAC_v2_mRNA19445

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by salicylic acid (SA) and gibberellic acid (GA) (PubMed:16463103). Triggered by dehydration and salt stress (PubMed:26243618). {ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:26243618}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_013470249.1	2e-36	transcription factor DIVARICATA
Swissprot	Q9FNN6	5e-19	SRM1_ARATH; Transcription factor SRM1
TrEMBL	A0A392LZ49	8e-59	A0A392LZ49_9FABA; Transcription factor DIVARICATA-like
STRING	AES84368	7e-36	(Medicago truncatula)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF13860	4	14

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G04760.1	8e-23	MYB family protein

Link Out ? help Back to Top
Phytozome	Tp57577_TGAC_v2_mRNA19445

Publications ? help Back to Top
Wang T, et al. Salt-Related MYB1 Coordinates Abscisic Acid Biosynthesis and Signaling during Salt Stress in Arabidopsis. Plant Physiol., 2015. 169(2): p. 1027-41 [PMID:26243618] Chen YS, et al. Two MYB-related transcription factors play opposite roles in sugar signaling in Arabidopsis. Plant Mol. Biol., 2017. 93(3): p. 299-311 [PMID:27866313]