PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Tp57577_TGAC_v2_mRNA22128

Organism

Trifolium pratense

Taxonomic ID

57577

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium

Family

ZF-HD

Protein Properties

Length: 86aa MW: 9329.34 Da PI: 7.7985

Description

ZF-HD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Tp57577_TGAC_v2_mRNA22128	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	ZF-HD_dimer	101.3	6.8e-32	19	74	3	59
ZF-HD_dimer 3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 v+Y eC+kNhAa++Gg+avDGC+Efm+s +eegt al+CaACgCHRnFH+re +e Tp57577_TGAC_v2_mRNA22128 19 VVKYGECQKNHAANVGGYAVDGCREFMAS-SEEGTNGALTCAACGCHRNFHKRELVE 74 699***********************9.8889*****************9865 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD125774	3.0E-24	1	83	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Pfam	PF04770	4.5E-30	20	71	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMs	TIGR01566	4.6E-26	21	71	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profile	PS51523	25.714	22	71	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain

Sequence ? help Back to Top
Protein Sequence Length: 86 aa Download sequence Send to blast
MRKRQVVVRR TEDSSQRSVV KYGECQKNHA ANVGGYAVDG CREFMASSEE GTNGALTCAA 60 CGCHRNFHKR ELVETETVSE CSNGT*

Functional Description ? help Back to Top
Source	Description
UniProt	Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. {ECO:0000269\|PubMed:21455630}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Tp57577_TGAC_v2_mRNA22128

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AC139600	2e-62	AC139600.16 Medicago truncatula chromosome 6 clone mth2-20m4, complete sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_019426943.1	2e-43	PREDICTED: mini zinc finger protein 2-like isoform X2
Swissprot	Q9LJW5	2e-31	MIF2_ARATH; Mini zinc finger protein 2
TrEMBL	A0A2K3N1Q8	4e-55	A0A2K3N1Q8_TRIPR; ZF-HD homeobox-like protein
STRING	XP_004489393.1	2e-38	(Cicer arietinum)
STRING	XP_004489394.1	2e-38	(Cicer arietinum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF1550	34	100

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G28917.1	8e-34	mini zinc finger 2

Link Out ? help Back to Top
Phytozome	Tp57577_TGAC_v2_mRNA22128

Publications ? help Back to Top
Bollier N, et al. At-MINI ZINC FINGER2 and Sl-INHIBITOR OF MERISTEM ACTIVITY, a Conserved Missing Link in the Regulation of Floral Meristem Termination in Arabidopsis and Tomato. Plant Cell, 2018. 30(1): p. 83-100 [PMID:29298836]