![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Tp57577_TGAC_v2_mRNA22388 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 104aa MW: 12330.3 Da PI: 10.3391 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 55.1 | 1.7e-17 | 22 | 69 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g+W+ eEd++l+ +++++G ++W+ ++ g+ R++k+c++rw +yl
Tp57577_TGAC_v2_mRNA22388 22 KGAWSMEEDQRLIAYIERHGHPNWRQLPKVAGLARCGKSCRLRWMNYL 69
79********************************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 21.933 | 17 | 73 | IPR017930 | Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 5.9E-23 | 17 | 72 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 1.9E-11 | 21 | 71 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 1.7E-15 | 22 | 69 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 9.71E-23 | 23 | 97 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 1.71E-9 | 24 | 69 | No hit | No description |
| PROSITE profile | PS50090 | 4.797 | 70 | 103 | IPR017877 | Myb-like domain |
| Gene3D | G3DSA:1.10.10.60 | 2.4E-9 | 73 | 98 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 104 aa Download sequence Send to blast |
HFNFVPKKMV RAPYFDENGT KKGAWSMEED QRLIAYIERH GHPNWRQLPK VAGLARCGKS 60 CRLRWMNYLR PNLKRGNYTQ KEEQMIMELN KKHGNKYDFV ISC* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1h8a_C | 5e-14 | 22 | 97 | 27 | 101 | MYB TRANSFORMING PROTEIN |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that regulates positively genes involved in anthocyanin biosynthesis such as A1. {ECO:0000269|PubMed:7920701}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Tp57577_TGAC_v2_mRNA22388 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_013443533.1 | 6e-57 | transcription factor MYB8 | ||||
| Swissprot | P20024 | 3e-37 | MYB1_MAIZE; Myb-related protein Zm1 | ||||
| TrEMBL | A0A072TL12 | 1e-55 | A0A072TL12_MEDTR; Myb transcription factor | ||||
| STRING | XP_004507244.1 | 3e-52 | (Cicer arietinum) | ||||
| STRING | GLYMA06G45520.1 | 2e-52 | (Glycine max) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF31 | 34 | 817 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G16770.2 | 2e-38 | myb domain protein 9 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Tp57577_TGAC_v2_mRNA22388 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




