![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Tp57577_TGAC_v2_mRNA22639 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 44aa MW: 4821.66 Da PI: 10.2287 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 32.2 | 2.5e-10 | 14 | 43 | 1 | 30 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHH CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIart 30
+g+WTt Ed ll ++v+ +G g+Wk+ +++
Tp57577_TGAC_v2_mRNA22639 14 KGPWTTKEDALLTKYVQAHGEGQWKSLPKK 43
79************************9886 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.60 | 5.8E-12 | 5 | 43 | IPR009057 | Homeodomain-like |
| SuperFamily | SSF46689 | 1.79E-8 | 8 | 43 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 12.575 | 9 | 44 | IPR017930 | Myb domain |
| Pfam | PF00249 | 8.2E-8 | 14 | 43 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 1.06E-4 | 16 | 43 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 44 aa Download sequence Send to blast |
MGRAPCCAKV GLHKGPWTTK EDALLTKYVQ AHGEGQWKSL PKKA |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Flavonol-specific transcription activator involved in the regulation of several genes of flavonoid biosynthesis. Activates the expression of CHS, CHI, F3H and FLS1. Controls flavonol biosynthesis primarily in cotyledons and leaves (PubMed:17419845, PubMed:20731781). Confers tolerance to UV-B (PubMed:19895401). {ECO:0000269|PubMed:17419845, ECO:0000269|PubMed:19895401, ECO:0000269|PubMed:20731781}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Tp57577_TGAC_v2_mRNA22639 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Triggered by HY5 in response to light and UV-B. {ECO:0000269|PubMed:19895401}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_013444592.1 | 5e-26 | myb-related protein 308 | ||||
| Swissprot | Q9FJ07 | 5e-17 | MY111_ARATH; Transcription factor MYB111 | ||||
| TrEMBL | A0A072TMG7 | 1e-24 | A0A072TMG7_MEDTR; Myb transcription factor | ||||
| TrEMBL | A0A2Z6N0A0 | 4e-25 | A0A2Z6N0A0_TRISU; Uncharacterized protein | ||||
| STRING | XP_004510651.1 | 5e-24 | (Cicer arietinum) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G49330.1 | 2e-19 | myb domain protein 111 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Tp57577_TGAC_v2_mRNA22639 |




