PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA22685
Organism
Trifolium pratense
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family MYB_related
Protein Properties Length: 94aa    MW: 11440.9 Da    PI: 8.7303
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA22685genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.81.6e-153175348
                               SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                WT+eEd++l d +  +G+++W+ Ia+++   +t  qc+ rw++yl
  Tp57577_TGAC_v2_mRNA22685 31 TWTQEEDDILRDQIGIHGTENWAIIASKFK-DKTTRQCRRRWYTYL 75
                               6****************************9.*************97 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.0992479IPR017930Myb domain
SMARTSM007174.7E-132877IPR001005SANT/Myb domain
CDDcd001672.96E-113175No hitNo description
Gene3DG3DSA:1.10.10.608.6E-223294IPR009057Homeodomain-like
PfamPF139213.9E-163292No hitNo description
SuperFamilySSF466893.71E-183293IPR009057Homeodomain-like
PROSITE profilePS500904.177694IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 94 aa     Download sequence    Send to blast
MQDMKKQHNQ NQKQKQLLNE ESKKKERHIV TWTQEEDDIL RDQIGIHGTE NWAIIASKFK  60
DKTTRQCRRR WYTYLNSDFK KGGWSPEEDM LLCE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-1232941072B-MYB
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds to DNA in promoters cis-regulatory element 5'-GGCGCGC-3' of cell cycle genes, including cyclins, cyclin-dependent kinases (CDKs), and components of the pre-replication complex (PubMed:20675570, PubMed:24687979). Binds to DNA in promoters cis-regulatory element 5'-AGCCG-3' of auxin regulated genes (e.g. PIN3 and PIN7) (PubMed:26578169). Together with FAMA and MYB88, ensures that stomata contain just two guard cells (GCs) by enforcing a single symmetric precursor cell division before stomatal maturity (PubMed:24571519). Represses the expression of the mitosis-inducing factors CDKB1-1 and CDKA-1, specifically required for the last guard mother cells (GMC) symmetric divisions in the stomatal pathway (PubMed:20675570, PubMed:24687979). Represses CYCA2-3 in newly formed guard cells (PubMed:21772250). Together with MYB88, regulates stomata spacing by restricting divisions late in the stomatal cell lineage thus limiting the number of GMC divisions (PubMed:11536724, PubMed:9684356, PubMed:16155180, PubMed:24123248). In collaboration with CDKB1-1 and CDKB1-2, restrict the G1/S transition and chloroplast and nuclear number during stomatal formation, and normally maintain fate and developmental progression throughout the stomatal cell lineage (PubMed:24123248). Also involved in the shape regulation of pavement cells (PubMed:9684356). Involved in sensing and/or transducing abiotic stress (e.g. drought and salt), probably via the positive regulation of NAC019 (PubMed:21105921). Regulates female reproduction being required for entry into megasporogenesis, probably via the regulation of cell cycle genes (PubMed:22915737). Promotes histone H3K27me3 marks and represses stem cell gene expression (PubMed:24654956). Required for lateral roots (LRs) initiation via the regulation of PIN3 expression in an auxin-dependent manner (PubMed:26578065). Involved in responses to gravity stimulation in primary roots by regulating the transcription of PIN3 and PIN7 in gravity-sensing cells, thus modulating auxin asymmetric redistribution (PubMed:26578169). {ECO:0000269|PubMed:11536724, ECO:0000269|PubMed:16155180, ECO:0000269|PubMed:20675570, ECO:0000269|PubMed:21105921, ECO:0000269|PubMed:21772250, ECO:0000269|PubMed:22915737, ECO:0000269|PubMed:24123248, ECO:0000269|PubMed:24571519, ECO:0000269|PubMed:24654956, ECO:0000269|PubMed:24687979, ECO:0000269|PubMed:26578065, ECO:0000269|PubMed:26578169, ECO:0000269|PubMed:9684356}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp57577_TGAC_v2_mRNA22685
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Strongly induced by auxin in a IAA14/SLR1 and ARF7 dependent manner, especially in xylem pole pericycle cells, lateral roots initiating cells. {ECO:0000269|PubMed:26578065}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003613635.12e-55transcription factor MYB124 isoform X2
RefseqXP_024640914.12e-55transcription factor MYB88 isoform X1
SwissprotQ94FL64e-44MY124_ARATH; Transcription factor MYB124
TrEMBLA0A2K3NHG92e-63A0A2K3NHG9_TRIPR; MYB transcription factor (Fragment)
TrEMBLA0A2Z6PK071e-61A0A2Z6PK07_TRISU; Uncharacterized protein
STRINGAES965936e-55(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF34803461
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14350.24e-46MYB family protein
Publications ? help Back to Top
  1. Yang M,Sack FD
    The too many mouths and four lips mutations affect stomatal production in Arabidopsis.
    Plant Cell, 1995. 7(12): p. 2227-39
    [PMID:11536724]
  2. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  3. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  4. Yang K, et al.
    Requirement for A-type cyclin-dependent kinase and cyclins for the terminal division in the stomatal lineage of Arabidopsis.
    J. Exp. Bot., 2014. 65(9): p. 2449-61
    [PMID:24687979]
  5. Yang M
    The FOUR LIPS (FLP) and MYB88 genes conditionally suppress the production of nonstomatal epidermal cells in Arabidopsis cotyledons.
    Am. J. Bot., 2016. 103(9): p. 1559-66
    [PMID:27620181]
  6. Xie Y, et al.
    An atypical R2R3 MYB transcription factor increases cold hardiness by CBF-dependent and CBF-independent pathways in apple.
    New Phytol., 2018. 218(1): p. 201-218
    [PMID:29266327]