![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Tp57577_TGAC_v2_mRNA23619 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
|
||||||||
| Family | HSF | ||||||||
| Protein Properties | Length: 71aa MW: 8109.09 Da PI: 8.9349 | ||||||||
| Description | HSF family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | HSF_DNA-bind | 81.5 | 1.2e-25 | 13 | 71 | 2 | 60 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS
HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60
Fl+k+y++++d+++++++sw +n nsfvv+ +f+k++LpkyFkh+nf+SFvRQLn+Y
Tp57577_TGAC_v2_mRNA23619 13 FLSKTYDMVDDSSTNTILSWGKNDNSFVVFSAADFSKHILPKYFKHNNFSSFVRQLNTY 71
9*********************************************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.10 | 8.6E-26 | 8 | 71 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| SMART | SM00415 | 3.0E-14 | 9 | 71 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| SuperFamily | SSF46785 | 1.77E-21 | 10 | 71 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| PRINTS | PR00056 | 8.5E-17 | 13 | 36 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Pfam | PF00447 | 4.6E-21 | 13 | 71 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 8.5E-17 | 51 | 63 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 8.5E-17 | 64 | 71 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 71 aa Download sequence Send to blast |
MTAGSVNYVI TPFLSKTYDM VDDSSTNTIL SWGKNDNSFV VFSAADFSKH ILPKYFKHNN 60 FSSFVRQLNT Y |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5hdk_A | 8e-19 | 10 | 71 | 7 | 68 | Heat shock factor protein 2 |
| 5hdk_B | 8e-19 | 10 | 71 | 7 | 68 | Heat shock factor protein 2 |
| 5hdk_C | 8e-19 | 10 | 71 | 7 | 68 | Heat shock factor protein 2 |
| 5hdk_D | 8e-19 | 10 | 71 | 7 | 68 | Heat shock factor protein 2 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE). | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Tp57577_TGAC_v2_mRNA23619 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: DNA-binding capacity is reduced by HSBP in vitro. {ECO:0000269|PubMed:20388662}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_012572685.1 | 5e-35 | heat stress transcription factor A-1b isoform X2 | ||||
| Refseq | XP_024638164.1 | 6e-35 | heat stress transcription factor A-1e | ||||
| Swissprot | O81821 | 1e-26 | HFA1B_ARATH; Heat stress transcription factor A-1b | ||||
| TrEMBL | A0A2Z6NNC3 | 2e-38 | A0A2Z6NNC3_TRISU; Uncharacterized protein | ||||
| STRING | XP_004505596.1 | 2e-37 | (Cicer arietinum) | ||||
| STRING | AES89630 | 2e-34 | (Medicago truncatula) | ||||
| STRING | AES89639 | 2e-34 | (Medicago truncatula) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF1592 | 33 | 95 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G16820.2 | 6e-29 | heat shock factor 3 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Tp57577_TGAC_v2_mRNA23619 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




