PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Tp57577_TGAC_v2_mRNA24623

Organism

Trifolium pratense

Taxonomic ID

57577

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium

Family

bZIP

Protein Properties

Length: 129aa MW: 14737 Da PI: 11.1372

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Tp57577_TGAC_v2_mRNA24623	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	51.7	1.9e-16	47	106	2	61
XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61 ++l++++r++kNRe+A rsR+RK+a++ eLe vk Le+eN +L +e e+k+ k+ + Tp57577_TGAC_v2_mRNA24623 47 AALQKQKRMIKNRESAARSRERKQAYTTELESQVKRLETENNQLLEEKAEMKNRRIKMLK 106 689***********************************************9999888776 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PRINTS	PR00041	3.5E-6	45	61	IPR001630	cAMP response element binding (CREB) protein
SMART	SM00338	1.9E-14	46	110	IPR004827	Basic-leucine zipper domain
Pfam	PF00170	3.5E-15	47	107	IPR004827	Basic-leucine zipper domain
PROSITE profile	PS50217	11.197	48	100	IPR004827	Basic-leucine zipper domain
CDD	cd14707	1.11E-13	50	98	No hit	No description
SuperFamily	SSF57959	1.44E-12	50	105	No hit	No description
Gene3D	G3DSA:1.20.5.170	5.7E-15	51	102	No hit	No description
PROSITE pattern	PS00036	0	53	68	IPR004827	Basic-leucine zipper domain
PRINTS	PR00041	3.5E-6	63	83	IPR001630	cAMP response element binding (CREB) protein
PRINTS	PR00041	3.5E-6	83	100	IPR001630	cAMP response element binding (CREB) protein

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 129 aa Download sequence Send to blast
LVRAGAVPGP APFSPHQYPS SSDASHSLQV STVKRKAVEE TLELDKAALQ KQKRMIKNRE 60 SAARSRERKQ AYTTELESQV KRLETENNQL LEEKAEMKNR RIKMLKEFVI PVTVQRRPKQ 120 KLRRLNSS*

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that binds to the ABA-responsive elements (ABREs) in vitro. Involved in abiotic stress responses and abscisic acid (ABA) signaling (PubMed:20039193). Involved in the signaling pathway that induces growth inhibition in response to D-allose (PubMed:23397192). {ECO:0000269\|PubMed:20039193, ECO:0000269\|PubMed:23397192}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Tp57577_TGAC_v2_mRNA24623

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by anoxia, drought, salt stress, oxidative stress, cold and abscisic acid (ABA) (PubMed:20039193). Induced by D-allose (PubMed:23397192). {ECO:0000269\|PubMed:20039193, ECO:0000269\|PubMed:23397192}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_013457259.2	7e-51	G-box-binding factor 4
Swissprot	Q0JHF1	8e-25	BZP12_ORYSJ; bZIP transcription factor 12
TrEMBL	A0A072UZK7	4e-37	A0A072UZK7_MEDTR; BZIP transcription factor
TrEMBL	A0A392PSU9	6e-38	A0A392PSU9_9FABA; G-box-binding factor 4-like (Fragment)
STRING	GLYMA08G08220.1	4e-30	(Glycine max)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF2028	34	81

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G03970.1	2e-22	G-box binding factor 4

Link Out ? help Back to Top
Phytozome	Tp57577_TGAC_v2_mRNA24623

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764]