![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Tp57577_TGAC_v2_mRNA30545 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
|
||||||||
| Family | GRAS | ||||||||
| Protein Properties | Length: 66aa MW: 7279.24 Da PI: 4.7725 | ||||||||
| Description | GRAS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | GRAS | 38.6 | 1.6e-12 | 19 | 66 | 2 | 49 |
GRAS 2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteAL 49
++lL+ecA++v+sg+ ++a+ L+ +s+++sp+g+++qR+++yf eAL
Tp57577_TGAC_v2_mRNA30545 19 ISLLIECAKCVASGSIKNADIGLEYISQISSPYGSAVQRVVTYFSEAL 66
579********************************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50985 | 10.347 | 1 | 66 | IPR005202 | Transcription factor GRAS |
| Pfam | PF03514 | 5.6E-10 | 19 | 66 | IPR005202 | Transcription factor GRAS |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 66 aa Download sequence Send to blast |
SPYQWLRELR CDSYSSNPIS LLIECAKCVA SGSIKNADIG LEYISQISSP YGSAVQRVVT 60 YFSEAL |
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Tp57577_TGAC_v2_mRNA30545 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | CT967304 | 7e-59 | CT967304.5 M.truncatula DNA sequence from clone MTH2-36C8 on chromosome 3, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_004513385.1 | 3e-34 | scarecrow-like protein 3 | ||||
| TrEMBL | A0A2Z6MW56 | 5e-35 | A0A2Z6MW56_TRISU; Uncharacterized protein | ||||
| STRING | XP_004513385.1 | 1e-33 | (Cicer arietinum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF14519 | 10 | 17 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G50420.1 | 2e-14 | scarecrow-like 3 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Tp57577_TGAC_v2_mRNA30545 |




