![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Tp57577_TGAC_v2_mRNA33291 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
|
||||||||
| Family | GATA | ||||||||
| Protein Properties | Length: 145aa MW: 15965 Da PI: 10.7541 | ||||||||
| Description | GATA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | GATA | 58.6 | 8.4e-19 | 60 | 93 | 1 | 34 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34
Cs+C++ kTp+WR gp g ktLCnaCG++y++ +
Tp57577_TGAC_v2_mRNA33291 60 CSHCQVQKTPQWRTGPLGAKTLCNACGVRYKSGR 93
*******************************987 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF57716 | 5.23E-15 | 53 | 116 | No hit | No description |
| SMART | SM00401 | 7.6E-15 | 54 | 108 | IPR000679 | Zinc finger, GATA-type |
| PROSITE profile | PS50114 | 11.424 | 54 | 90 | IPR000679 | Zinc finger, GATA-type |
| Gene3D | G3DSA:3.30.50.10 | 4.0E-15 | 58 | 91 | IPR013088 | Zinc finger, NHR/GATA-type |
| CDD | cd00202 | 7.66E-13 | 59 | 116 | No hit | No description |
| Pfam | PF00320 | 1.1E-16 | 60 | 94 | IPR000679 | Zinc finger, GATA-type |
| PROSITE pattern | PS00344 | 0 | 60 | 85 | IPR000679 | Zinc finger, GATA-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0008270 | Molecular Function | zinc ion binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 145 aa Download sequence Send to blast |
LGSXXXXXXX XXXPLLLRPF FPSPPPLVSG EPPAKKQKKK AQAQVGDVEA QGEAHLQRRC 60 SHCQVQKTPQ WRTGPLGAKT LCNACGVRYK SGRLFSEYRP ACSPTFSSEI HSNSHRKVLE 120 MRKRKGMVGP EPGLPAQTQM VRTC* |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes (By similarity). {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Tp57577_TGAC_v2_mRNA33291 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | GU443965 | 1e-160 | GU443965.1 Trifolium repens clone BAC 99k01 zinc knuckle (ccHc-type) family proteins, metal ion binding protein, zinc finger (GATA type) family protein, ferredoxin hydrogenase, SH3 domain-containing protein, kinesin-related protein, salt tolerance-like protein, dehydrin b, zinc-mediated transcriptional activator, 26S proteasome AAA-ATPase subunit RPT4a, inositol monophosphatase, dehydrin, and zinc ion binding protein genes, complete cds; and unknown genes. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_004500773.1 | 1e-64 | GATA transcription factor 7 | ||||
| Swissprot | Q9FH57 | 1e-39 | GATA5_ARATH; GATA transcription factor 5 | ||||
| TrEMBL | A0A2K3PB09 | 2e-92 | A0A2K3PB09_TRIPR; GATA transcription factor | ||||
| STRING | XP_004500773.1 | 5e-64 | (Cicer arietinum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF1108 | 34 | 107 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G66320.2 | 7e-40 | GATA transcription factor 5 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Tp57577_TGAC_v2_mRNA33291 |




