PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Tp57577_TGAC_v2_mRNA35519

Organism

Trifolium pratense

Taxonomic ID

57577

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium

Family

CAMTA

Protein Properties

Length: 91aa MW: 10967.1 Da PI: 11.3087

Description

CAMTA family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Tp57577_TGAC_v2_mRNA35519	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	CG-1	69	7.4e-22	47	87	36	76
CG-1 36 sgsliLynrkkvryfrkDGyswkkkkdgktvrEdhekLKvg 76 gsl+L++rk++ryfrkDG++w+k+kdgktvrE+he+LK+ Tp57577_TGAC_v2_mRNA35519 47 GGSLLLFDRKVTRYFRKDGHNWRKQKDGKTVREAHERLKIR 87 59*************************************95 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51437	29.383	1	90	IPR005559	CG-1 DNA-binding domain
SMART	SM01076	7.4E-5	27	90	IPR005559	CG-1 DNA-binding domain
Pfam	PF03859	2.2E-16	47	87	IPR005559	CG-1 DNA-binding domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 91 aa Download sequence Send to blast
LYQKHNIDGY VQLKFAKFSL IRPTFRLLLN LHICLQFLIM VFWITLGGSL LLFDRKVTRY 60 FRKDGHNWRK QKDGKTVREA HERLKIRIHK *

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Tp57577_TGAC_v2_mRNA35519

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_012437208.1	2e-20	PREDICTED: calmodulin-binding transcription activator 3 isoform X2
Refseq	XP_012437209.1	2e-20	PREDICTED: calmodulin-binding transcription activator 3 isoform X2
Refseq	XP_012437210.1	2e-20	PREDICTED: calmodulin-binding transcription activator 3 isoform X2
Refseq	XP_012437211.1	2e-20	PREDICTED: calmodulin-binding transcription activator 3 isoform X2
Refseq	XP_016738097.1	2e-20	PREDICTED: calmodulin-binding transcription activator 3-like isoform X2
Refseq	XP_016738099.1	2e-20	PREDICTED: calmodulin-binding transcription activator 3-like isoform X2
Refseq	XP_016738100.1	2e-20	PREDICTED: calmodulin-binding transcription activator 3-like isoform X2
TrEMBL	A0A2G5E9C5	2e-25	A0A2G5E9C5_AQUCA; Uncharacterized protein
STRING	EMJ09374	2e-18	(Prunus persica)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF31762	2	2

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G09410.1	7e-21	ethylene induced calmodulin binding protein

Link Out ? help Back to Top
Phytozome	Tp57577_TGAC_v2_mRNA35519