![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Tp57577_TGAC_v2_mRNA36797 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 51aa MW: 6122.08 Da PI: 4.6859 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 43.4 | 1.1e-13 | 14 | 51 | 1 | 39 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdi 39
l+pGfrFhPtdeelv +yLk+k+++k+l++ e ik+vdi
Tp57577_TGAC_v2_mRNA36797 14 LMPGFRFHPTDEELVGFYLKRKIQQKSLPI-ELIKQVDI 51
689***************************.89***997 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF101941 | 7.98E-13 | 12 | 51 | IPR003441 | NAC domain |
| PROSITE profile | PS51005 | 16.32 | 14 | 51 | IPR003441 | NAC domain |
| Pfam | PF02365 | 1.7E-8 | 16 | 39 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 51 aa Download sequence Send to blast |
MEERTEMDNK VDDLMPGFRF HPTDEELVGF YLKRKIQQKS LPIELIKQVD I |
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Tp57577_TGAC_v2_mRNA36797 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT144729 | 2e-61 | BT144729.1 Medicago truncatula clone JCVI-FLMt-18B11 unknown mRNA. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_013450964.1 | 4e-27 | protein FEZ isoform X2 | ||||
| Refseq | XP_024641515.1 | 4e-27 | protein FEZ isoform X1 | ||||
| Swissprot | Q9FIW5 | 2e-16 | NAC94_ARATH; Putative NAC domain-containing protein 94 | ||||
| TrEMBL | A0A072U5H5 | 8e-26 | A0A072U5H5_MEDTR; NAC domain class transcription factor | ||||
| TrEMBL | I3SW81 | 6e-27 | I3SW81_MEDTR; Uncharacterized protein | ||||
| STRING | GLYMA19G02580.1 | 1e-22 | (Glycine max) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF11433 | 17 | 39 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G39820.1 | 8e-19 | NAC domain containing protein 94 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Tp57577_TGAC_v2_mRNA36797 |




