PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Tp57577_TGAC_v2_mRNA38845

Organism

Trifolium pratense

Taxonomic ID

57577

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium

Family

NAC

Protein Properties

Length: 151aa MW: 17787.2 Da PI: 10.018

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Tp57577_TGAC_v2_mRNA38845	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	182.8	8.6e-57	11	140	1	129
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksg 81 +ppGfrFhPtdeelv++yL+kkv +kk++l +vik+vd+yk+ePwdL++ k+ + e+++wyfFs++dkky+tg+r+nratk+g Tp57577_TGAC_v2_mRNA38845 11 VPPGFRFHPTDEELVDYYLRKKVLSKKIDL-DVIKDVDLYKIEPWDLQElcKIGSdEQNDWYFFSHKDKKYPTGTRTNRATKAG 93 69**************************.9***********954555553555********************* PP NAM 82 yWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129 +Wkatg+dk+++s k+ lvg++ktLvfykgrap+g+k+dW+mheyrle Tp57577_TGAC_v2_mRNA38845 94 FWKATGRDKAIYS-KQFLVGMRKTLVFYKGRAPNGQKSDWIMHEYRLE 140 *********.9999**************************85 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	6.8E-58	8	144	IPR003441	NAC domain
PROSITE profile	PS51005	54.849	11	150	IPR003441	NAC domain
Pfam	PF02365	6.7E-30	12	139	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 151 aa Download sequence Send to blast
LRRNMNTFSH VPPGFRFHPT DEELVDYYLR KKVLSKKIDL DVIKDVDLYK IEPWDLQELC 60 KIGSDEQNDW YFFSHKDKKY PTGTRTNRAT KAGFWKATGR DKAIYSKQFL VGMRKTLVFY 120 KGRAPNGQKS DWIMHEYRLE TNQNGTSQVN *

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3ulx_A	1e-49	3	139	7	140	Stress-induced transcription factor NAC1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity). Involved in xylem formation by promoting the expression of secondary wall-associated transcription factors and of genes involved in secondary wall biosynthesis and programmed cell death, genes driven by the secondary wall NAC binding element (SNBE). Triggers thickening of secondary walls (PubMed:16103214, PubMed:25148240). {ECO:0000250\|UniProtKB:Q9LVA1, ECO:0000269\|PubMed:16103214, ECO:0000269\|PubMed:25148240}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Tp57577_TGAC_v2_mRNA38845

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AC155228	1e-123	AC155228.11 Medicago truncatula chromosome 8 clone mth2-139i19, complete sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_024636703.1	1e-104	NAC domain-containing protein 7 isoform X1
Swissprot	Q9FWX2	2e-94	NAC7_ARATH; NAC domain-containing protein 7
TrEMBL	A0A2K3K8P2	1e-109	A0A2K3K8P2_TRIPR; NAC domain-containing protein (Fragment)
STRING	AES90959	1e-102	(Medicago truncatula)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF1269	33	106

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G12260.1	5e-85	NAC 007

Link Out ? help Back to Top
Phytozome	Tp57577_TGAC_v2_mRNA38845

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Heyndrickx KS,Vandepoele K Systematic identification of functional plant modules through the integration of complementary data sources. Plant Physiol., 2012. 159(3): p. 884-901 [PMID:22589469]