![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Tp57577_TGAC_v2_mRNA40629 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 74aa MW: 8784.22 Da PI: 10.5881 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 52.6 | 1.1e-16 | 21 | 68 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g W++eEde+l ++ + G g+W+ +ar g+ R++k+c++rw +yl
Tp57577_TGAC_v2_mRNA40629 21 KGLWSPEEDEKLMNYMVRNGQGCWSDVARNAGLERCGKSCRLRWINYL 68
678*******************************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.60 | 6.8E-23 | 13 | 74 | IPR009057 | Homeodomain-like |
| SuperFamily | SSF46689 | 4.19E-17 | 16 | 74 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 23.817 | 16 | 72 | IPR017930 | Myb domain |
| SMART | SM00717 | 2.2E-11 | 20 | 70 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 3.9E-15 | 21 | 68 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 1.48E-8 | 24 | 68 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 74 aa Download sequence Send to blast |
MRKPEVCSTK NNNINKKKLR KGLWSPEEDE KLMNYMVRNG QGCWSDVARN AGLERCGKSC 60 RLRWINYLRP DLKR |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator. Involved in the regulation of secondary wall biosynthesis in fibers and vessels (PubMed:17890373). Transcription activator of the mannan synthase CSLA9 that recognizes and binds to the DNA consensus sequence 5'-[AG][GT]T[AT]GGT[GA]-3' cis-regulatory element of CSLA9 promoter (PubMed:24243147). Transcription factor that acts as molecular switch in the NAC012/SND1-mediated transcriptional network regulating secondary wall biosynthesis. Is directly activated by NAC012/SND1. Functions redundantly with MYB83 in the transcriptional regulatory cascade leading to secondary wall formation in fibers and vessels (PubMed:19808805). Transcription activator that binds to the DNA consensus sequence 5'-ACC[AT]A[AC][TC]-3', designated as the secondary wall MYB-responsive element (SMRE). Regulates directly numerous transcription factors and a number of genes involved in secondary wall biosynthesis that contain SMRE elements in their promoters (PubMed:22197883). Is an obligate component of the transcriptional regulatory complex toward the commitment of secondary wall cellulose synthesis. Is required for functional expression of the three secondary wall CESA genes, CESA4, CESA7 and CESA8 (PubMed:23726771). {ECO:0000269|PubMed:17890373, ECO:0000269|PubMed:19808805, ECO:0000269|PubMed:22197883, ECO:0000269|PubMed:23726771, ECO:0000269|PubMed:24243147}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Tp57577_TGAC_v2_mRNA40629 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Slightly induced by salicylic acid (SA). Positively regulated by SND1 and homolog proteins. {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:17890373}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC146330 | 2e-90 | AC146330.33 Medicago truncatula clone mth2-7g7, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_027342869.1 | 5e-40 | transcription factor MYB46-like | ||||
| Swissprot | Q9LXV2 | 3e-34 | MYB46_ARATH; Transcription factor MYB46 | ||||
| TrEMBL | A0A2K3JVU7 | 4e-37 | A0A2K3JVU7_TRIPR; Transcription factor MYB 46-like protein (Fragment) | ||||
| TrEMBL | G7IS01 | 7e-37 | G7IS01_MEDTR; Myb transcription factor | ||||
| STRING | AES67674 | 3e-37 | (Medicago truncatula) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF774 | 34 | 128 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G12870.1 | 6e-35 | myb domain protein 46 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Tp57577_TGAC_v2_mRNA40629 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




