![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Tp57577_TGAC_v2_mRNA40813 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 82aa MW: 9794.34 Da PI: 11.0153 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 52.3 | 1.3e-16 | 35 | 75 | 6 | 47 |
HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
Myb_DNA-binding 6 teEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
+eEd +l ++v+q+G ++W++I+r++ gR++k+c++rw +
Tp57577_TGAC_v2_mRNA40813 35 AEEDRILTRLVEQHGARNWSLISRYIK-GRSGKSCRLRWCNQ 75
69************************9.***********985 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 17.371 | 25 | 80 | IPR017930 | Myb domain |
| SMART | SM00717 | 3.2E-10 | 29 | 78 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 3.01E-12 | 35 | 74 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 2.6E-18 | 35 | 81 | IPR009057 | Homeodomain-like |
| SuperFamily | SSF46689 | 9.72E-15 | 35 | 81 | IPR009057 | Homeodomain-like |
| Pfam | PF00249 | 5.6E-15 | 35 | 75 | IPR001005 | SANT/Myb domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 82 aa Download sequence Send to blast |
KLFNNNIFIR LMFIXXXXXX XXXXXXXXXX XXXXAEEDRI LTRLVEQHGA RNWSLISRYI 60 KGRSGKSCRL RWCNQLSPTV EH |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that functions in salt stress response. Acts as negative regulator of NHX7/SOS1 and CBL4/SOS3 induction in response to salt stress (PubMed:23809151). In response to auxin, activates the transcription of the auxin-responsive gene IAA19. The IAA19 transcription activation by MYB73 is enhanced by direct interaction between MYB73 and PYL8 (PubMed:24894996). {ECO:0000269|PubMed:23809151, ECO:0000269|PubMed:24894996}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Tp57577_TGAC_v2_mRNA40813 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by salt stress. {ECO:0000269|PubMed:23809151}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_003603000.1 | 4e-27 | transcription factor MYB73 | ||||
| Swissprot | O23160 | 1e-20 | MYB73_ARATH; Transcription factor MYB73 | ||||
| TrEMBL | A0A2Z6NXB2 | 9e-26 | A0A2Z6NXB2_TRISU; Uncharacterized protein | ||||
| STRING | AES73251 | 2e-26 | (Medicago truncatula) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF5074 | 32 | 56 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G37260.1 | 4e-23 | myb domain protein 73 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Tp57577_TGAC_v2_mRNA40813 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




