![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Tp57577_TGAC_v2_mRNA41069 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 73aa MW: 8352.81 Da PI: 10.9728 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 97.5 | 5.7e-31 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
krien + rqvtfskRrng+lKKA+ELSvLCdaeva+i+fs++g+lye++s
Tp57577_TGAC_v2_mRNA41069 9 KRIENPTSRQVTFSKRRNGLLKKAFELSVLCDAEVALIVFSPRGRLYEFAS 59
79***********************************************86 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00432 | 8.1E-41 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 31.651 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 7.85E-30 | 3 | 62 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.1E-31 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 5.57E-38 | 3 | 60 | No hit | No description |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 3.4E-28 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.1E-31 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.1E-31 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 73 aa Download sequence Send to blast |
MVRGKTQMKR IENPTSRQVT FSKRRNGLLK KAFELSVLCD AEVALIVFSP RGRLYEFASS 60 RYVSCTCFRL FN* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1tqe_P | 4e-18 | 1 | 60 | 1 | 60 | Myocyte-specific enhancer factor 2B |
| 1tqe_Q | 4e-18 | 1 | 60 | 1 | 60 | Myocyte-specific enhancer factor 2B |
| 1tqe_R | 4e-18 | 1 | 60 | 1 | 60 | Myocyte-specific enhancer factor 2B |
| 1tqe_S | 4e-18 | 1 | 60 | 1 | 60 | Myocyte-specific enhancer factor 2B |
| 6c9l_A | 4e-18 | 1 | 60 | 1 | 60 | Myocyte-specific enhancer factor 2B |
| 6c9l_B | 4e-18 | 1 | 60 | 1 | 60 | Myocyte-specific enhancer factor 2B |
| 6c9l_C | 4e-18 | 1 | 60 | 1 | 60 | Myocyte-specific enhancer factor 2B |
| 6c9l_D | 4e-18 | 1 | 60 | 1 | 60 | Myocyte-specific enhancer factor 2B |
| 6c9l_E | 4e-18 | 1 | 60 | 1 | 60 | Myocyte-specific enhancer factor 2B |
| 6c9l_F | 4e-18 | 1 | 60 | 1 | 60 | Myocyte-specific enhancer factor 2B |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor active in flowering time control. May control internode elongation and promote floral transition phase. May act upstream of the floral regulators MADS1, MADS14, MADS15 and MADS18 in the floral induction pathway. {ECO:0000269|PubMed:15144377, ECO:0000269|PubMed:17166135}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Tp57577_TGAC_v2_mRNA41069 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT053478 | 8e-62 | BT053478.1 Medicago truncatula clone MTYFP_FQ_FR_FS1G-E-5 unknown mRNA. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_007134936.1 | 8e-37 | hypothetical protein PHAVU_010G088100g | ||||
| Refseq | XP_007134937.1 | 8e-37 | hypothetical protein PHAVU_010G088100g | ||||
| Refseq | XP_022678747.1 | 3e-35 | MADS-box transcription factor 50 isoform X1 | ||||
| Refseq | XP_022678748.1 | 3e-35 | MADS-box transcription factor 50 isoform X1 | ||||
| Swissprot | Q9XJ60 | 6e-36 | MAD50_ORYSJ; MADS-box transcription factor 50 | ||||
| TrEMBL | A0A0E0CUE4 | 3e-36 | A0A0E0CUE4_9ORYZ; Uncharacterized protein | ||||
| STRING | EMT27929 | 6e-37 | (Aegilops tauschii) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF119 | 33 | 360 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G11880.1 | 8e-37 | AGAMOUS-like 14 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Tp57577_TGAC_v2_mRNA41069 |




