PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Tp57577_TGAC_v2_mRNA547

Organism

Trifolium pratense

Taxonomic ID

57577

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium

Family

M-type_MADS

Protein Properties

Length: 143aa MW: 15988.5 Da PI: 10.3437

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Tp57577_TGAC_v2_mRNA547	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	61	1.3e-19	16	64	1	49
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49 k+ +n+sn qvtfskR ++KKA+E ++LC+++va++ifs++ k++ + Tp57577_TGAC_v2_mRNA547 16 KKMSNESNLQVTFSKRCIDLFKKASEFCTLCGVDVALVIFSPSEKVFSF 64 5689*****************************************9987 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	4.8E-27	8	67	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	21.516	8	68	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	4.97E-25	9	85	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	7.1E-16	10	30	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	6.3E-22	18	64	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	7.1E-16	30	45	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	7.1E-16	45	66	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 143 aa Download sequence Send to blast
MLNGKKGKGR QKIEMKKMSN ESNLQVTFSK RCIDLFKKAS EFCTLCGVDV ALVIFSPSEK 60 VFSFGHPNID TVINRYISRV PLQNNSSMQF IEAHRNTTLS DLNAQLSQMN NTLDNEKKRG 120 DELSLLRKAT RLSFGGLVQL MG*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5f28_A	1e-14	9	111	2	93	MEF2C
5f28_B	1e-14	9	111	2	93	MEF2C
5f28_C	1e-14	9	111	2	93	MEF2C
5f28_D	1e-14	9	111	2	93	MEF2C
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor. Required for suppression of cellularization and promotion of nuclear proliferation during early endosperm development. The FERTILIZATION-INDEPENDENT SEED (FIS) polycomb complex is required for suppression of ALG62 expression at the end of the syncytial phase of endosperm development. {ECO:0000269\|PubMed:18334668}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Tp57577_TGAC_v2_mRNA547

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004496799.1	3e-67	agamous-like MADS-box protein AGL62
Swissprot	Q9FKK2	2e-46	AGL62_ARATH; Agamous-like MADS-box protein AGL62
TrEMBL	A0A2Z6N555	1e-75	A0A2Z6N555_TRISU; Uncharacterized protein
STRING	XP_004496799.1	1e-66	(Cicer arietinum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF128	33	331

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G60440.1	7e-49	AGAMOUS-like 62

Link Out ? help Back to Top
Phytozome	Tp57577_TGAC_v2_mRNA547

Publications ? help Back to Top
Xu W, et al. Endosperm and Nucellus Develop Antagonistically in Arabidopsis Seeds. Plant Cell, 2016. 28(6): p. 1343-60 [PMID:27233529] Figueiredo DD,Batista RA,Roszak PJ,Köhler C Auxin production couples endosperm development to fertilization. Nat Plants, 2015. 1: p. 15184 [PMID:27251719] Figueiredo DD,Batista RA,Roszak PJ,Hennig L,Köhler C Auxin production in the endosperm drives seed coat development in Arabidopsis. Elife, 2017. [PMID:27848912] Fiume E,Coen O,Xu W,Lepiniec L,Magnani E Growth of the Arabidopsis sub-epidermal integument cell layers might require an endosperm signal. Plant Signal Behav, 2017. 12(8): p. e1339000 [PMID:28613109] Zhang S, et al. FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development. Plant Physiol., 2018. 177(1): p. 285-299 [PMID:29523711]