![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Tp57577_TGAC_v2_mRNA6197 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 138aa MW: 15382.3 Da PI: 5.0748 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 174 | 1.6e-54 | 20 | 113 | 4 | 97 |
NF-YB 4 qdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylk 88
q+r+lPianv+rimkk+lPa+akisk++ket+qecvsefisf+t+eas+kcq+ekrktingddllwa++tlGfe+y+eplk yl+
Tp57577_TGAC_v2_mRNA6197 20 QERLLPIANVGRIMKKALPAKAKISKESKETMQECVSEFISFITGEASEKCQKEKRKTINGDDLLWAMTTLGFEEYAEPLKGYLH 104
89*********************************************************************************** PP
NF-YB 89 kyrelegek 97
+yre+eg+k
Tp57577_TGAC_v2_mRNA6197 105 RYREIEGDK 113
*******97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 1.1E-50 | 19 | 118 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 4.19E-39 | 20 | 116 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 9.8E-28 | 23 | 87 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 2.6E-20 | 51 | 69 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 54 | 70 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 2.6E-20 | 70 | 88 | No hit | No description |
| PRINTS | PR00615 | 2.6E-20 | 89 | 107 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 138 aa Download sequence Send to blast |
MAESDDESGG QASGSRELLQ ERLLPIANVG RIMKKALPAK AKISKESKET MQECVSEFIS 60 FITGEASEKC QKEKRKTING DDLLWAMTTL GFEEYAEPLK GYLHRYREIE GDKNFSMSMI 120 GKEQQGSSST DNRFFQG* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4g91_B | 3e-45 | 20 | 108 | 4 | 92 | Transcription factor HapC (Eurofung) |
| 4g92_B | 3e-45 | 20 | 108 | 4 | 92 | Transcription factor HapC (Eurofung) |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Tp57577_TGAC_v2_mRNA6197 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | JQ918281 | 1e-141 | JQ918281.1 Medicago truncatula nuclear trancsription factor Y subunit B8 (NF-YB8) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_013458655.1 | 4e-84 | nuclear transcription factor Y subunit B-3 | ||||
| Swissprot | O23310 | 4e-59 | NFYB3_ARATH; Nuclear transcription factor Y subunit B-3 | ||||
| TrEMBL | A0A2K3KF71 | 1e-95 | A0A2K3KF71_TRIPR; Nuclear transcription factor Y subunit B-3-like protein (Fragment) | ||||
| STRING | XP_004507593.1 | 9e-76 | (Cicer arietinum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF591 | 34 | 150 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G14540.1 | 2e-61 | nuclear factor Y, subunit B3 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Tp57577_TGAC_v2_mRNA6197 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




