PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Tp57577_TGAC_v2_mRNA6197

Organism

Trifolium pratense

Taxonomic ID

57577

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium

Family

NF-YB

Protein Properties

Length: 138aa MW: 15382.3 Da PI: 5.0748

Description

NF-YB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Tp57577_TGAC_v2_mRNA6197	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YB	174	1.6e-54	20	113	4	97
NF-YB 4 qdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylk 88 q+r+lPianv+rimkk+lPa+akisk++ket+qecvsefisf+t+eas+kcq+ekrktingddllwa++tlGfe+y+eplk yl+ Tp57577_TGAC_v2_mRNA6197 20 QERLLPIANVGRIMKKALPAKAKISKESKETMQECVSEFISFITGEASEKCQKEKRKTINGDDLLWAMTTLGFEEYAEPLKGYLH 104 89********************************************************************************* PP NF-YB 89 kyrelegek 97 +yre+eg+k Tp57577_TGAC_v2_mRNA6197 105 RYREIEGDK 113 *****97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.20.10	1.1E-50	19	118	IPR009072	Histone-fold
SuperFamily	SSF47113	4.19E-39	20	116	IPR009072	Histone-fold
Pfam	PF00808	9.8E-28	23	87	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain
PRINTS	PR00615	2.6E-20	51	69	No hit	No description
PROSITE pattern	PS00685	0	54	70	IPR003956	Transcription factor, NFYB/HAP3, conserved site
PRINTS	PR00615	2.6E-20	70	88	No hit	No description
PRINTS	PR00615	2.6E-20	89	107	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 138 aa Download sequence Send to blast
MAESDDESGG QASGSRELLQ ERLLPIANVG RIMKKALPAK AKISKESKET MQECVSEFIS 60 FITGEASEKC QKEKRKTING DDLLWAMTTL GFEEYAEPLK GYLHRYREIE GDKNFSMSMI 120 GKEQQGSSST DNRFFQG*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4g91_B	3e-45	20	108	4	92	Transcription factor HapC (Eurofung)
4g92_B	3e-45	20	108	4	92	Transcription factor HapC (Eurofung)
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Tp57577_TGAC_v2_mRNA6197

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	JQ918281	1e-141	JQ918281.1 Medicago truncatula nuclear trancsription factor Y subunit B8 (NF-YB8) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_013458655.1	4e-84	nuclear transcription factor Y subunit B-3
Swissprot	O23310	4e-59	NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBL	A0A2K3KF71	1e-95	A0A2K3KF71_TRIPR; Nuclear transcription factor Y subunit B-3-like protein (Fragment)
STRING	XP_004507593.1	9e-76	(Cicer arietinum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF591	34	150

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G14540.1	2e-61	nuclear factor Y, subunit B3

Link Out ? help Back to Top
Phytozome	Tp57577_TGAC_v2_mRNA6197

Publications ? help Back to Top
Han X, et al. Overexpression of the poplar NF-YB7 transcription factor confers drought tolerance and improves water-use efficiency in Arabidopsis. J. Exp. Bot., 2013. 64(14): p. 4589-601 [PMID:24006421] Hwang YH, et al. Functional conservation of rice OsNF-YB/YC and Arabidopsis AtNF-YB/YC proteins in the regulation of flowering time. Plant Cell Rep., 2016. 35(4): p. 857-65 [PMID:26754793] Hossain MA, et al. Identification of Novel Components of the Unfolded Protein Response in Arabidopsis. Front Plant Sci, 2016. 7: p. 650 [PMID:27242851] Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722]