PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Tp57577_TGAC_v2_mRNA6252

Organism

Trifolium pratense

Taxonomic ID

57577

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium

Family

NF-YB

Protein Properties

Length: 113aa MW: 12607.4 Da PI: 8.3159

Description

NF-YB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Tp57577_TGAC_v2_mRNA6252	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YB	148.1	1.9e-46	5	96	3	94
NF-YB 3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkk 89 e d+ lPianvsrimk+ lP nakisk++k+++qec++efisfvtseasdkc++e+rkt++gdd++wal++lGf++y+e++ yl k Tp57577_TGAC_v2_mRNA6252 5 EGDKTLPIANVSRIMKQNLPPNAKISKESKQLMQECATEFISFVTSEASDKCHKENRKTVSGDDICWALCSLGFDNYAEAIGRYLYK 91 679********************************************************************************** PP NF-YB 90 yrele 94 +r++e Tp57577_TGAC_v2_mRNA6252 92 FRQAE 96 987 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.20.10	1.1E-45	4	108	IPR009072	Histone-fold
SuperFamily	SSF47113	3.88E-35	7	99	IPR009072	Histone-fold
Pfam	PF00808	3.2E-26	9	73	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain
PRINTS	PR00615	1.2E-16	37	55	No hit	No description
PROSITE pattern	PS00685	0	40	56	IPR003956	Transcription factor, NFYB/HAP3, conserved site
PRINTS	PR00615	1.2E-16	56	74	No hit	No description
PRINTS	PR00615	1.2E-16	75	93	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 113 aa Download sequence Send to blast
MNGGEGDKTL PIANVSRIMK QNLPPNAKIS KESKQLMQEC ATEFISFVTS EASDKCHKEN 60 RKTVSGDDIC WALCSLGFDN YAEAIGRYLY KFRQAELVKL NQNKLETSKD KV*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4g91_B	4e-39	5	94	3	92	Transcription factor HapC (Eurofung)
4g92_B	4e-39	5	94	3	92	Transcription factor HapC (Eurofung)
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Tp57577_TGAC_v2_mRNA6252

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AC151426	1e-103	AC151426.32 Medicago truncatula clone mth2-6o22, complete sequence.
GenBank	AC161241	1e-103	AC161241.18 Medicago truncatula clone mth2-193c3, complete sequence.
GenBank	JQ918284	1e-103	JQ918284.1 Medicago truncatula nuclear transcription factor Y subunit B11 (NF-YB11) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_003591124.1	2e-70	nuclear transcription factor Y subunit B-4
Swissprot	O04027	1e-48	NFYB4_ARATH; Nuclear transcription factor Y subunit B-4
TrEMBL	A0A2K3PJX9	1e-77	A0A2K3PJX9_TRIPR; Nuclear transcription factor Y subunit B-5-like protein
STRING	AES61375	1e-69	(Medicago truncatula)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF805	32	131

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G09030.1	5e-51	nuclear factor Y, subunit B4

Link Out ? help Back to Top
Phytozome	Tp57577_TGAC_v2_mRNA6252

Publications ? help Back to Top
Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722]