![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Tp57577_TGAC_v2_mRNA7357 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
|
||||||||
| Family | HSF | ||||||||
| Protein Properties | Length: 110aa MW: 12628 Da PI: 4.6366 | ||||||||
| Description | HSF family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | HSF_DNA-bind | 84.3 | 1.8e-26 | 52 | 110 | 2 | 60 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS
HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60
Fl+k+y+++ed+++++++sw+++g sfvv+d++ f++++Lp+yFkh+nf+SFvRQLn+Y
Tp57577_TGAC_v2_mRNA7357 52 FLTKTYDVVEDPTTSHIVSWNRDGASFVVWDPNAFSRDLLPRYFKHNNFSSFVRQLNTY 110
9*********************************************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.10 | 1.4E-28 | 45 | 110 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| SMART | SM00415 | 3.4E-21 | 48 | 110 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| SuperFamily | SSF46785 | 2.99E-24 | 50 | 110 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| Pfam | PF00447 | 1.2E-22 | 52 | 110 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 5.7E-17 | 52 | 75 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 5.7E-17 | 90 | 102 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 5.7E-17 | 103 | 110 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 110 aa Download sequence Send to blast |
MNYLYPVKEE YLEIEATSSS ASTTYERGSD EGSMVVIPRP MEGLHEVGPP PFLTKTYDVV 60 EDPTTSHIVS WNRDGASFVV WDPNAFSRDL LPRYFKHNNF SSFVRQLNTY |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5d8k_B | 3e-18 | 50 | 110 | 3 | 63 | Heat shock factor protein 2 |
| 5d8l_B | 3e-18 | 50 | 110 | 3 | 63 | Heat shock factor protein 2 |
| 5d8l_D | 3e-18 | 50 | 110 | 3 | 63 | Heat shock factor protein 2 |
| 5d8l_F | 3e-18 | 50 | 110 | 3 | 63 | Heat shock factor protein 2 |
| 5d8l_H | 3e-18 | 50 | 110 | 3 | 63 | Heat shock factor protein 2 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator that specifically binds DNA of heat shock promoter elements (HSE). {ECO:0000269|PubMed:16202242}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Tp57577_TGAC_v2_mRNA7357 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By heat stress. {ECO:0000269|PubMed:16202242}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | DQ455122 | 3e-65 | DQ455122.1 Medicago truncatula cDNA-AFLP fragment BC21M13_50 sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_024625396.1 | 2e-68 | heat stress transcription factor A-6b isoform X1 | ||||
| Refseq | XP_024625397.1 | 2e-68 | heat stress transcription factor A-6b isoform X2 | ||||
| Swissprot | Q338B0 | 3e-39 | HFA2C_ORYSJ; Heat stress transcription factor A-2c | ||||
| TrEMBL | A0A2K3LXY8 | 4e-76 | A0A2K3LXY8_TRIPR; Heat stress transcription factor a-6b-like protein | ||||
| STRING | XP_004493725.1 | 8e-60 | (Cicer arietinum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF1592 | 33 | 95 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G22830.1 | 3e-38 | heat shock transcription factor A6B | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Tp57577_TGAC_v2_mRNA7357 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




