![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Tp6g01080 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 77aa MW: 8911.2 Da PI: 6.7928 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 29.1 | 2.3e-09 | 34 | 72 | 4 | 44 |
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44
+ +eE++l + +k+ G + W++Ia +++ gRt++++ +w
Tp6g01080 34 MNQEEQDLVCRMHKLVGDR-WELIAGRIP-GRTAEEIEKFW 72
67899999999******99.*********.********999 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00717 | 2.7E-4 | 30 | 76 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 9.06E-6 | 33 | 72 | No hit | No description |
| SuperFamily | SSF46689 | 2.26E-7 | 35 | 73 | IPR009057 | Homeodomain-like |
| Gene3D | G3DSA:1.10.10.60 | 5.7E-11 | 35 | 73 | IPR009057 | Homeodomain-like |
| Pfam | PF00249 | 3.9E-8 | 35 | 73 | IPR001005 | SANT/Myb domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0009651 | Biological Process | response to salt stress | ||||
| GO:0009737 | Biological Process | response to abscisic acid | ||||
| GO:0009751 | Biological Process | response to salicylic acid | ||||
| GO:0009753 | Biological Process | response to jasmonic acid | ||||
| GO:0010026 | Biological Process | trichome differentiation | ||||
| GO:0010228 | Biological Process | vegetative to reproductive phase transition of meristem | ||||
| GO:0048765 | Biological Process | root hair cell differentiation | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 77 aa Download sequence Send to blast |
MDKHLMTKRT KTNPIVASSS SAEVSSLEWE GVNMNQEEQD LVCRMHKLVG DRWELIAGRI 60 PGRTAEEIEK FWVMKNH |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. Determines the fate of epidermal cell differentiation. Represses trichome development by lateral inhibition. Together with GL3 or BHLH2, promotes the formation of hair developing cells (H position) in root epidermis, probably by inhibiting non-hair cell formation. Represses the expression of GL2 and WER in H cells. Positively regulates stomatal formation in the hypocotyl (PubMed:19513241). {ECO:0000269|PubMed:11910008, ECO:0000269|PubMed:12356720, ECO:0000269|PubMed:16291794, ECO:0000269|PubMed:19513241, ECO:0000269|PubMed:9262483}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Tp6g01080 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Transcriptional repression correlates with reduced histone acetylation on H3 and H4 mediated by HDA18 in root epidermis N cells (non-hair developing cells). Induced by WER. Negative autoregulation by interfering with the binding of WER to its WER-binding sites (WBS) promoter region, especially in H cells. Down-regulated by GEM. Down-regulated by TMM (PubMed:19513241). {ECO:0000269|PubMed:11910008, ECO:0000269|PubMed:15795220, ECO:0000269|PubMed:16176989, ECO:0000269|PubMed:16207757, ECO:0000269|PubMed:17450124, ECO:0000269|PubMed:19513241}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | LC142708 | 3e-64 | LC142708.1 Brassica rapa subsp. nipposinica ETC1 mRNA for MYB-like transcription factor ETC1, partial cds, cultivar: Kyo-mizore. | |||
| GenBank | LC142709 | 3e-64 | LC142709.1 Brassica rapa subsp. nipposinica ETC1 mRNA for MYB-like transcription factor ETC1, partial cds, cultivar: Kyo-nishiki. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009128504.1 | 6e-44 | PREDICTED: MYB-like transcription factor ETC3 isoform X1 | ||||
| Refseq | XP_013719386.1 | 6e-44 | MYB-like transcription factor ETC3 isoform X1 | ||||
| Refseq | XP_024009863.1 | 6e-44 | MYB-like transcription factor ETC3 isoform X2 | ||||
| Swissprot | O22059 | 2e-28 | CPC_ARATH; Transcription factor CPC | ||||
| TrEMBL | A0A3P6AVG3 | 1e-42 | A0A3P6AVG3_BRACM; Uncharacterized protein | ||||
| TrEMBL | M4CWE2 | 1e-42 | M4CWE2_BRARP; Uncharacterized protein | ||||
| STRING | Bra008539.1-P | 2e-43 | (Brassica rapa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM323 | 28 | 194 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G01060.2 | 2e-32 | CAPRICE-like MYB3 | ||||




