![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Tp6g16960 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 102aa MW: 11119.6 Da PI: 10.7681 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 53.1 | 7.3e-17 | 30 | 77 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g+WT+ Ede+l+ +v++ G g+W+++ + g+ R++k+c++rw ++l
Tp6g16960 30 KGPWTAAEDEILAAYVRENGEGNWNAVQKNTGLARCGKSCRLRWANHL 77
79******************************************9996 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 21.069 | 25 | 81 | IPR017930 | Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 3.0E-21 | 28 | 85 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 1.6E-12 | 29 | 79 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 1.3E-15 | 30 | 77 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 8.58E-17 | 31 | 87 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 1.28E-9 | 32 | 77 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 102 aa Download sequence Send to blast |
MILYGGGAGK DGGSTNHISD GGGGGVVLKK GPWTAAEDEI LAAYVRENGE GNWNAVQKNT 60 GLARCGKSCR LRWANHLRPN LKKRLFHRRR RTSHYPASCS AW |
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 81 | 90 | KKRLFHRRRR |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator (PubMed:24278028). Binds to 5'-CAACTGTC-3' and/or 5'-TAACAAA-3' motif in target gene promoter to promote their expression (By similarity). Together with MYB97 and MYB101, functions as a male factor that controls pollen tube-synergid interaction in fertilization. Required for pollen tube growth arrest and sperm cell release in the female gametophyte, probably via the regulation of pollen tube-specific gene expression (PubMed:24278028, PubMed:23791732). {ECO:0000250|UniProtKB:O80883, ECO:0000269|PubMed:23791732, ECO:0000269|PubMed:24278028}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Tp6g16960 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Accumulates in pollen tube 4 hours after pollen germination. {ECO:0000269|PubMed:19714218}. | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC189303 | 1e-115 | AC189303.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB030F12, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_018475832.1 | 8e-45 | PREDICTED: transcription factor MYB86 | ||||
| Swissprot | Q94FL7 | 6e-40 | MY120_ARATH; Transcription factor MYB120 | ||||
| TrEMBL | A0A078J922 | 9e-44 | A0A078J922_BRANA; BnaC03g71630D protein | ||||
| STRING | Bra028997.1-P | 1e-43 | (Brassica rapa) | ||||
| STRING | A0A087GB55 | 9e-44 | (Arabis alpina) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G55020.1 | 2e-34 | myb domain protein 120 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




