![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Tp6g40120 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 144aa MW: 16271.4 Da PI: 9.273 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 60 | 5.1e-19 | 76 | 122 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g WT+eEde l +av ++ g++Wk+Ia+ ++ Rt+ qc +rwqk+l
Tp6g40120 76 KGGWTPEEDETLRQAVDKYKGKRWKKIAEFFP-DRTEVQCLHRWQKVL 122
688*****************************.************986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 25.338 | 71 | 126 | IPR017930 | Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 4.6E-22 | 72 | 133 | IPR009057 | Homeodomain-like |
| SuperFamily | SSF46689 | 3.34E-19 | 73 | 134 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 2.1E-16 | 75 | 124 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 1.4E-17 | 76 | 122 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 1.25E-15 | 79 | 122 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 144 aa Download sequence Send to blast |
MSSNSNPATG SPEKEEISEL KVEIHCMENK QPTPVSCSSA SEGSGNFFLK SPEITTPAAT 60 ASPTPRRTSG PMRRAKGGWT PEEDETLRQA VDKYKGKRWK KIAEFFPDRT EVQCLHRWQK 120 VLNPELVKGP WTQEVFTRSY RQAM |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1h88_C | 3e-19 | 75 | 134 | 5 | 64 | MYB PROTO-ONCOGENE PROTEIN |
| 1h89_C | 3e-19 | 75 | 134 | 5 | 64 | MYB PROTO-ONCOGENE PROTEIN |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that binds 5'-AACGG-3' motifs in gene promoters (By similarity). Transcription repressor that regulates organ growth. Binds to the promoters of G2/M-specific genes and to E2F target genes to prevent their expression in post-mitotic cells and to restrict the time window of their expression in proliferating cells (PubMed:26069325). {ECO:0000250|UniProtKB:Q94FL9, ECO:0000269|PubMed:26069325}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Tp6g40120 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Slightly induced by ethylene and salicylic acid (SA). {ECO:0000269|PubMed:16463103}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AY519649 | 1e-125 | AY519649.1 Arabidopsis thaliana MYB transcription factor (At5g02320) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_179013.2 | 1e-77 | Homeodomain-like superfamily protein | ||||
| Refseq | XP_006287439.1 | 1e-75 | transcription factor MYB3R-5 | ||||
| Swissprot | Q6R032 | 4e-74 | MB3R5_ARATH; Transcription factor MYB3R-5 | ||||
| TrEMBL | Q29PZ8 | 3e-76 | Q29PZ8_ARATH; At2g13960 | ||||
| TrEMBL | R0FDT2 | 2e-74 | R0FDT2_9BRAS; Uncharacterized protein | ||||
| STRING | Bostr.6251s0040.1.p | 6e-78 | (Boechera stricta) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM30442 | 2 | 2 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G13960.1 | 6e-72 | MYB_related family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




