![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Traes_1AL_002FAE6E8.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 48aa MW: 5602.22 Da PI: 6.9388 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 55.9 | 9.9e-18 | 4 | 47 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
rg ++++E++ +v +++ lG++ W+ Ia++++ gRt++++k++w++
Traes_1AL_002FAE6E8.1 4 RGCFSQQEEDHIVALHHILGNR-WSQIASHLP-GRTDNEIKNFWNS 47
899*******************.*********.***********96 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 23.577 | 1 | 48 | IPR017930 | Myb domain |
| SuperFamily | SSF46689 | 6.24E-14 | 1 | 47 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 5.2E-8 | 3 | 48 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 7.4E-16 | 4 | 47 | IPR001005 | SANT/Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 2.0E-20 | 6 | 47 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 3.72E-10 | 7 | 46 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 48 aa Download sequence Send to blast |
DLKRGCFSQQ EEDHIVALHH ILGNRWSQIA SHLPGRTDNE IKNFWNSC |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Possible transcription activator in response to an external signal. May be involved in the regulation of flavonoid biosynthesis. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK364378 | 8e-70 | AK364378.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2024H18. | |||
| GenBank | X70878 | 8e-70 | X70878.1 H.vulgare myb3 mRNA. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020186841.1 | 5e-29 | myb-related protein Hv33-like isoform X3 | ||||
| Swissprot | P20027 | 5e-28 | MYB3_HORVU; Myb-related protein Hv33 | ||||
| TrEMBL | A0A3B5Y571 | 1e-28 | A0A3B5Y571_WHEAT; Uncharacterized protein | ||||
| TrEMBL | M7ZL77 | 9e-29 | M7ZL77_TRIUA; Myb-related protein Hv33 | ||||
| STRING | TRIUR3_08099-P1 | 1e-29 | (Triticum urartu) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G01680.3 | 4e-23 | myb domain protein 55 | ||||




