PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Traes_1AS_1432A2F79.1

Organism

Triticum aestivum

Taxonomic ID

4565

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum

Family

WRKY

Protein Properties

Length: 123aa MW: 13730.3 Da PI: 9.9678

Description

WRKY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Traes_1AS_1432A2F79.1	genome	IWGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRKY	97.4	9.5e-31	35	93	1	59
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDg++WrKYG+K vk+s++pr+YYrC+ +gC vkk+ver+++dp++v++tY g Hnh Traes_1AS_1432A2F79.1 35 LDDGFKWRKYGKKAVKNSPNPRNYYRCSAEGCGVKKRVERDRDDPRYVVTTYDGVHNHA 93 59********************************************************6 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:2.20.25.80	1.3E-32	23	95	IPR003657	WRKY domain
SuperFamily	SSF118290	3.01E-28	27	95	IPR003657	WRKY domain
PROSITE profile	PS50811	31.582	30	95	IPR003657	WRKY domain
SMART	SM00774	7.6E-35	35	94	IPR003657	WRKY domain
Pfam	PF03106	1.5E-24	36	92	IPR003657	WRKY domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0009867	Biological Process	jasmonic acid mediated signaling pathway
GO:0050832	Biological Process	defense response to fungus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 123 aa Download sequence Send to blast
GAGDDEHRGE KKIKISARVS SGRIGFRTRS EVEILDDGFK WRKYGKKAVK NSPNPRNYYR 60 CSAEGCGVKK RVERDRDDPR YVVTTYDGVH NHATPGAAAQ YYCYSPPRSS PPAAYSAAGL 120 LQF

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1wj2_A	3e-29	20	95	2	77	Probable WRKY transcription factor 4
2lex_A	3e-29	20	95	2	77	Probable WRKY transcription factor 4
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00531	DAP	Transfer from AT5G26170	Download

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK357196	1e-168	AK357196.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1048A03.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020169646.1	8e-84	probable WRKY transcription factor 24
Swissprot	Q8VWQ5	5e-40	WRK50_ARATH; Probable WRKY transcription factor 50
TrEMBL	A0A191XX76	2e-85	A0A191XX76_WHEAT; WRKY transcription factor (Fragment)
TrEMBL	A0A3B5XXX8	5e-85	A0A3B5XXX8_WHEAT; Uncharacterized protein
STRING	Traes_1AS_1432A2F79.1	4e-86	(Triticum aestivum)
STRING	TRIUR3_29978-P1	2e-85	(Triticum urartu)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP441	37	206

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G26170.1	2e-42	WRKY DNA-binding protein 50

Publications ? help Back to Top
Brand LH,Kirchler T,Hummel S,Chaban C,Wanke D DPI-ELISA: a fast and versatile method to specify the binding of plant transcription factors to DNA in vitro. Plant Methods, 2010. 6: p. 25 [PMID:21108821] Brenchley R, et al. Analysis of the bread wheat genome using whole-genome shotgun sequencing. Nature, 2012. 491(7426): p. 705-10 [PMID:23192148]