PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Traes_1AS_1B1587F7D.1

Organism

Triticum aestivum

Taxonomic ID

4565

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum

Family

TALE

Protein Properties

Length: 200aa MW: 22354.5 Da PI: 6.665

Description

TALE family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Traes_1AS_1B1587F7D.1	genome	IWGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Homeobox	30.4	6.6e-10	131	164	22	55
SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS Homeobox 22 nrypsaeereeLAkklgLterqVkvWFqNrRake 55 +yp++e++ +LA+ +gL+ +q+ +WF N+R ++ Traes_1AS_1B1587F7D.1 131 WPYPTEEDKVRLAAMTGLDPKQINNWFINQRKRH 164 59*****************************885 PP
2	ELK	33.9	6.9e-12	84	105	1	22
ELK 1 ELKhqLlrKYsgyLgsLkqEFs 22 ELK++Ll+KYsg+L+ L++EF+ Traes_1AS_1B1587F7D.1 84 ELKEMLLKKYSGCLSRLRSEFL 105 9********************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF03789	8.0E-9	84	105	IPR005539	ELK domain
PROSITE profile	PS51213	10.423	84	104	IPR005539	ELK domain
SMART	SM01188	3.6E-6	84	105	IPR005539	ELK domain
PROSITE profile	PS50071	12.519	104	167	IPR001356	Homeobox domain
SMART	SM00389	3.3E-14	106	171	IPR001356	Homeobox domain
SuperFamily	SSF46689	3.08E-20	106	176	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	6.9E-27	109	169	IPR009057	Homeodomain-like
CDD	cd00086	1.30E-13	116	168	No hit	No description
Pfam	PF05920	2.7E-17	124	163	IPR008422	Homeobox KN domain
PROSITE pattern	PS00027	0	142	165	IPR017970	Homeobox, conserved site

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 200 aa Download sequence Send to blast
MLSCSASEVV PLSSPNLDLL YTVAQPCNLI LTQHITLSNP CLISIVSIMQ DEMVGSSEDE 60 PCSGDADGSD AGMQEHSSRL ADHELKEMLL KKYSGCLSRL RSEFLKKRKK GKLPKDARLA 120 LMDWWNTHYR WPYPTEEDKV RLAAMTGLDP KQINNWFINQ RKRHWKPSED MRFALMEGVT 180 GGGGSSSGTT LYFDTGTIGP

Nucleic Localization Signal ? help Back to Top

No.	Start	End	Sequence
1	99	108	LRSEFLKKRK
2	105	109	KKRKK

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor that may be involved in shoot formation during embryogenesis. {ECO:0000269\|PubMed:10080693}.
UniProt	Probable transcription factor that may be involved in shoot formation during embryogenesis. {ECO:0000269\|PubMed:10080693, ECO:0000269\|PubMed:10488233}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK363615	0.0	AK363615.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2017F18.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020178258.1	1e-90	homeobox protein knotted-1-like 10
Swissprot	A2Y007	9e-91	KNOSA_ORYSI; Homeobox protein knotted-1-like 10
Swissprot	Q7GDL5	9e-91	KNOSA_ORYSJ; Homeobox protein knotted-1-like 10
TrEMBL	A0A446ILQ1	1e-148	A0A446ILQ1_TRITD; Uncharacterized protein
STRING	Traes_1AS_1B1587F7D.1	1e-149	(Triticum aestivum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP1698	38	92

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G23380.2	7e-40	KNOTTED1-like homeobox gene 6

Publications ? help Back to Top
Ito Y,Eiguchi M,Kurata N KNOX homeobox genes are sufficient in maintaining cultured cells in an undifferentiated state in rice. Genesis, 2001. 30(4): p. 231-8 [PMID:11536429] Postma-Haarsma AD, et al. Developmental regulation and downstream effects of the knox class homeobox genes Oskn2 and Oskn3 from rice. Plant Mol. Biol., 2002. 48(4): p. 423-41 [PMID:11908517] Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Kuijt SJ, et al. Different subcellular localization and trafficking properties of KNOX class 1 homeodomain proteins from rice. Plant Mol. Biol., 2004. 55(6): p. 781-96 [PMID:15604716] Cheng CH, et al. A fine physical map of the rice chromosome 5. Mol. Genet. Genomics, 2005. 274(4): p. 337-45 [PMID:16261349] Brenchley R, et al. Analysis of the bread wheat genome using whole-genome shotgun sequencing. Nature, 2012. 491(7426): p. 705-10 [PMID:23192148] Chu H, et al. A CLE-WOX signalling module regulates root meristem maintenance and vascular tissue development in rice. J. Exp. Bot., 2013. 64(17): p. 5359-69 [PMID:24043854] Kuijt SJ, et al. Interaction between the GROWTH-REGULATING FACTOR and KNOTTED1-LIKE HOMEOBOX families of transcription factors. Plant Physiol., 2014. 164(4): p. 1952-66 [PMID:24532604] Coudert Y, et al. Identification of CROWN ROOTLESS1-regulated genes in rice reveals specific and conserved elements of postembryonic root formation. New Phytol., 2015. 206(1): p. 243-54 [PMID:25442012] Xu Y, et al. OsARID3, an AT-rich Interaction Domain-containing protein, is required for shoot meristem development in rice. Plant J., 2015. 83(5): p. 806-17 [PMID:26121094] Kir G, et al. RNA Interference Knockdown of BRASSINOSTEROID INSENSITIVE1 in Maize Reveals Novel Functions for Brassinosteroid Signaling in Controlling Plant Architecture. Plant Physiol., 2015. 169(1): p. 826-39 [PMID:26162429]