![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Traes_1AS_24511D656.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 75aa MW: 8375.69 Da PI: 10.2346 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 87.7 | 6.3e-28 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
++ien++ rqvtfskR+ g++KKA EL vLCda+vav++fs+tg+ly+yss
Traes_1AS_24511D656.1 9 EKIENTTSRQVTFSKRKSGLFKKARELGVLCDAQVAVLLFSNTGRLYDYSS 59
58***********************************************96 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 28.903 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 1.6E-34 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 3.8E-26 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 7.34E-33 | 3 | 60 | No hit | No description |
| SuperFamily | SSF55455 | 2.09E-26 | 3 | 61 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 5.0E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 3.8E-26 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 3.8E-26 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 75 aa Download sequence Send to blast |
MVRGKTVIEK IENTTSRQVT FSKRKSGLFK KARELGVLCD AQVAVLLFSN TGRLYDYSSS 60 NSGYVNFDPL LLTIV |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5f28_A | 5e-15 | 1 | 65 | 1 | 65 | MEF2C |
| 5f28_B | 5e-15 | 1 | 65 | 1 | 65 | MEF2C |
| 5f28_C | 5e-15 | 1 | 65 | 1 | 65 | MEF2C |
| 5f28_D | 5e-15 | 1 | 65 | 1 | 65 | MEF2C |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | MADS-box transcription factor that acts with AGL42 and AGL72 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1. {ECO:0000269|PubMed:21609362}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK371442 | 2e-65 | AK371442.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2134C13. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020165070.1 | 5e-34 | MADS-box transcription factor 23-like | ||||
| Swissprot | Q9LT93 | 1e-26 | AGL71_ARATH; MADS-box protein AGL71 | ||||
| TrEMBL | A0A3B5XUD9 | 1e-36 | A0A3B5XUD9_WHEAT; Uncharacterized protein | ||||
| TrEMBL | A0A446IJN4 | 2e-37 | A0A446IJN4_TRITD; Uncharacterized protein | ||||
| STRING | Traes_1AS_24511D656.1 | 8e-48 | (Triticum aestivum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP129 | 38 | 398 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G51870.2 | 2e-29 | AGAMOUS-like 71 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




