![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Traes_1AS_59001495A.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | YABBY | ||||||||
| Protein Properties | Length: 47aa MW: 5557.25 Da PI: 9.2593 | ||||||||
| Description | YABBY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | YABBY | 83 | 8.6e-26 | 2 | 42 | 130 | 170 |
YABBY 130 nrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170
n +i+eei+rika+nPdishreafs+aaknWah+P+ihfgl
Traes_1AS_59001495A.1 2 NLMIREEIRRIKANNPDISHREAFSTAAKNWAHYPNIHFGL 42
789************************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF04690 | 8.0E-24 | 2 | 42 | IPR006780 | YABBY protein |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0007275 | Biological Process | multicellular organism development | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 47 aa Download sequence Send to blast |
INLMIREEIR RIKANNPDIS HREAFSTAAK NWAHYPNIHF GLNPERD |
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT009106 | 3e-63 | BT009106.1 Triticum aestivum clone wkm2n.pk008.p10:fis, full insert mRNA sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020152569.1 | 2e-24 | protein YABBY 6-like, partial | ||||
| Swissprot | Q2QM17 | 3e-22 | YAB6_ORYSJ; Protein YABBY 6 | ||||
| TrEMBL | A0A453JK09 | 5e-23 | A0A453JK09_AEGTS; Uncharacterized protein | ||||
| STRING | Traes_1AS_59001495A.1 | 4e-27 | (Triticum aestivum) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G26580.2 | 5e-22 | YABBY family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




