![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Traes_1AS_8C62DF06E.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | HB-other | ||||||||
| Protein Properties | Length: 73aa MW: 8315.33 Da PI: 10.464 | ||||||||
| Description | HB-other family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Homeobox | 53.9 | 3.1e-17 | 8 | 55 | 9 | 56 |
HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
Homeobox 9 keqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
+ q+ +Lee+F+k+++p++++ + L++++g++ q+++WFq rRa+ k
Traes_1AS_8C62DF06E.1 8 PRQILVLEEAFKKCPHPDQTQVANLSRETGMEVHQIQYWFQTRRAQIK 55
78*******************************************977 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00389 | 3.1E-11 | 1 | 61 | IPR001356 | Homeobox domain |
| SuperFamily | SSF46689 | 9.41E-16 | 7 | 67 | IPR009057 | Homeodomain-like |
| Pfam | PF00046 | 9.6E-15 | 8 | 55 | IPR001356 | Homeobox domain |
| CDD | cd00086 | 2.12E-13 | 8 | 55 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 4.8E-15 | 8 | 59 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS50071 | 12.455 | 10 | 57 | IPR001356 | Homeobox domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 73 aa Download sequence Send to blast |
MDGHRRAPRQ ILVLEEAFKK CPHPDQTQVA NLSRETGMEV HQIQYWFQTR RAQIKGSSSN 60 TRPPTKGSSS PDP |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor. {ECO:0000250}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020150479.1 | 2e-16 | homeobox-leucine zipper protein ROC8-like | ||||
| Swissprot | Q69T58 | 9e-16 | ROC8_ORYSJ; Homeobox-leucine zipper protein ROC8 | ||||
| TrEMBL | A0A452XN11 | 1e-36 | A0A452XN11_AEGTS; Uncharacterized protein | ||||
| STRING | Traes_1AS_8C62DF06E.1 | 1e-48 | (Triticum aestivum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP25104 | 2 | 5 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G73360.1 | 3e-15 | homeodomain GLABROUS 11 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




