![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Traes_1AS_D3AEB9F29.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | GRAS | ||||||||
| Protein Properties | Length: 71aa MW: 8600.75 Da PI: 9.6623 | ||||||||
| Description | GRAS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | GRAS | 37.5 | 3.5e-12 | 2 | 65 | 300 | 364 |
GRAS 300 cegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkd 364
ega+r+er e++++W++r+ +aGF+++p+ k +++ + ++++ + e++g+l++gWk+
Traes_1AS_D3AEB9F29.1 2 VEGADRTERPESYRQWQARFFKAGFQQLPVAPAFFKRVHMKNSLYHEE-FFAVEHRGWLIQGWKG 65
599*******************************************55.8888999*******96 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50985 | 10.569 | 1 | 56 | IPR005202 | Transcription factor GRAS |
| Pfam | PF03514 | 1.2E-9 | 2 | 65 | IPR005202 | Transcription factor GRAS |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 71 aa Download sequence Send to blast |
HVEGADRTER PESYRQWQAR FFKAGFQQLP VAPAFFKRVH MKNSLYHEEF FAVEHRGWLI 60 QGWKGYIQME T |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor involved in plant development. {ECO:0000250}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020198294.1 | 6e-36 | scarecrow-like protein 9 | ||||
| Swissprot | P0C884 | 2e-15 | SCL34_ARATH; Scarecrow-like protein 34 | ||||
| TrEMBL | A0A446IID8 | 5e-33 | A0A446IID8_TRITD; Uncharacterized protein | ||||
| TrEMBL | R7WF62 | 1e-34 | R7WF62_AEGTA; Uncharacterized protein | ||||
| STRING | Traes_1AS_D3AEB9F29.1 | 1e-46 | (Triticum aestivum) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G29065.1 | 8e-18 | GRAS family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




