![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Traes_1BL_1B12D7856.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 71aa MW: 8108.28 Da PI: 10.9865 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 28.7 | 3.1e-09 | 9 | 47 | 9 | 47 |
HHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
Myb_DNA-binding 9 dellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
+ ++++ +++G g+W+ I+r k+Rt+ q+ s+ qky
Traes_1BL_1B12D7856.1 9 HAMFLEGLEKYGRGDWRNISRWSVKTRTPTQVASHAQKY 47
6679**********************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 10.131 | 1 | 52 | IPR017930 | Myb domain |
| TIGRFAMs | TIGR01557 | 6.1E-13 | 8 | 51 | IPR006447 | Myb domain, plants |
| SuperFamily | SSF46689 | 3.43E-13 | 8 | 53 | IPR009057 | Homeodomain-like |
| Gene3D | G3DSA:1.10.10.60 | 1.8E-6 | 10 | 47 | IPR009057 | Homeodomain-like |
| Pfam | PF00249 | 4.9E-6 | 10 | 47 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 8.66E-7 | 11 | 48 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 71 aa Download sequence Send to blast |
MIPLAPPCHA MFLEGLEKYG RGDWRNISRW SVKTRTPTQV ASHAQKYFIR QANAATRGDS 60 KRKSIHDITN P |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Involved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | JF951937 | 1e-97 | JF951937.1 Triticum aestivum clone TaMYB54 MYB-related protein mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020158940.1 | 2e-39 | transcription factor DIVARICATA-like | ||||
| Swissprot | Q8S9H7 | 4e-22 | DIV_ANTMA; Transcription factor DIVARICATA | ||||
| TrEMBL | A0A446K2T9 | 5e-47 | A0A446K2T9_TRITD; Uncharacterized protein | ||||
| STRING | Traes_1BL_1B12D7856.1 | 8e-48 | (Triticum aestivum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP2895 | 36 | 87 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G38090.1 | 5e-25 | MYB family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




