PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_1BL_1D865A8CC.1
Organism
Triticum aestivum
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family WRKY
Protein Properties Length: 67aa    MW: 7928.07 Da    PI: 8.0752
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_1BL_1D865A8CC.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY56.36.6e-189462259
                           EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                   WRKY 22 rsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
                            sYYrCt+++C+vkk+v+r a+d+++v++tYeg Hnh+
  Traes_1BL_1D865A8CC.1  9 ESYYRCTHHTCNVKKQVQRLAKDTSIVVTTYEGVHNHP 46
                           69***********************************8 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007742.6E-8147IPR003657WRKY domain
SuperFamilySSF1182902.35E-14847IPR003657WRKY domain
PfamPF031066.4E-13946IPR003657WRKY domain
Gene3DG3DSA:2.20.25.807.4E-15946IPR003657WRKY domain
PROSITE profilePS5081114.9521048IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 67 aa     Download sequence    Send to blast
YDPYIFQSES YYRCTHHTCN VKKQVQRLAK DTSIVVTTYE GVHNHPCEKL MEALNPILRQ  60
LQFLSQL
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ8404122e-71DQ840412.1 Hordeum vulgare subsp. vulgare WRKY transcription factor 13 (WRKY13) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020160818.16e-37probable WRKY transcription factor 75
SwissprotQ9FFS34e-32WRK24_ARATH; Probable WRKY transcription factor 24
TrEMBLA0A3B5Z3812e-36A0A3B5Z381_WHEAT; Uncharacterized protein
STRINGTraes_1BL_1D865A8CC.18e-44(Triticum aestivum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP110038133
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41570.12e-34WRKY DNA-binding protein 24
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]