![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Traes_1BL_6F6239DF9.2 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 148aa MW: 16608.2 Da PI: 5.9777 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 166.7 | 2.9e-52 | 14 | 105 | 2 | 93 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkk 89
+eq+rflPian++rim++ +P+n+ki+kdake++qecvsefisf+tseasdkc +ekrktingddl+w+++tlGfedyveplk+ylk
Traes_1BL_6F6239DF9.2 14 KEQERFLPIANIGRIMRRGVPENGKIAKDAKESIQECVSEFISFITSEASDKCMKEKRKTINGDDLIWSMGTLGFEDYVEPLKLYLKL 101
89************************************************************************************** PP
NF-YB 90 yrel 93
yre+
Traes_1BL_6F6239DF9.2 102 YREV 105
**97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 3.5E-46 | 11 | 104 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 2.75E-36 | 16 | 105 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 2.4E-26 | 19 | 83 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 2.5E-19 | 47 | 65 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 50 | 66 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 2.5E-19 | 66 | 84 | No hit | No description |
| PRINTS | PR00615 | 2.5E-19 | 85 | 103 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0016021 | Cellular Component | integral component of membrane | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 148 aa Download sequence Send to blast |
MSEAVGTPES GGAKEQERFL PIANIGRIMR RGVPENGKIA KDAKESIQEC VSEFISFITS 60 EASDKCMKEK RKTINGDDLI WSMGTLGFED YVEPLKLYLK LYREVIFIHS FVPLFLCCLC 120 YACAACERNS EFGVRRRFGG YSIGVGEL |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4awl_B | 1e-43 | 14 | 104 | 4 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| 4csr_A | 1e-43 | 14 | 104 | 4 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. May regulate the expression of photosynthetic genes, and may be involved in chloroplast and amyloplast development. {ECO:0000269|PubMed:14617083}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | KM078742 | 1e-172 | KM078742.1 Triticum aestivum CCAAT-binding transcription factor A (NFYB-D11) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020174231.1 | 5e-71 | nuclear transcription factor Y subunit B-4-like | ||||
| Swissprot | Q65XK1 | 1e-58 | NFYB4_ORYSJ; Nuclear transcription factor Y subunit B-4 | ||||
| TrEMBL | A0A446KCW5 | 1e-104 | A0A446KCW5_TRITD; Uncharacterized protein | ||||
| STRING | Traes_1BL_6F6239DF9.2 | 1e-105 | (Triticum aestivum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP201 | 38 | 331 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G53340.1 | 6e-55 | nuclear factor Y, subunit B10 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




