PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_1BL_B34F44FC1.1
Organism
Triticum aestivum
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family GATA
Protein Properties Length: 99aa    MW: 10939.5 Da    PI: 10.8344
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_1BL_B34F44FC1.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA63.23e-202558134
                   GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34
                           C++Cgt +Tp+WR+gpdg k+LCnaCG++yr  +
  Traes_1BL_B34F44FC1.1 25 CRHCGTAETPQWREGPDGRKMLCNACGVRYRAGR 58
                           *******************************877 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004012.9E-151973IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.8E-152380No hitNo description
Gene3DG3DSA:3.30.50.107.1E-162457IPR013088Zinc finger, NHR/GATA-type
PROSITE profilePS5011411.6482555IPR000679Zinc finger, GATA-type
PfamPF003203.6E-182559IPR000679Zinc finger, GATA-type
CDDcd002022.44E-142573No hitNo description
PROSITE patternPS0034402550IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 99 aa     Download sequence    Send to blast
MEPTEGAARR AVASPALSGL GQLLCRHCGT AETPQWREGP DGRKMLCNAC GVRYRAGRLV  60
PEYRPLRSPT FSPELHTNRH SRVAQMRSAR APHPLPPDK
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes (By similarity). {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022685360.12e-32GATA transcription factor 5-like
SwissprotQ9SV304e-27GATA8_ARATH; GATA transcription factor 8
TrEMBLA0A3B5YW932e-63A0A3B5YW93_WHEAT; Uncharacterized protein
TrEMBLA0A446JSJ92e-63A0A446JSJ9_TRITD; Uncharacterized protein
STRINGTraes_1BL_B34F44FC1.12e-66(Triticum aestivum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP59623656
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54810.22e-29GATA family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]
  2. Choi D, et al.
    iNID: an analytical framework for identifying network models for interplays among developmental signaling in Arabidopsis.
    Mol Plant, 2014. 7(5): p. 792-813
    [PMID:24380880]
  3. Li T,Wu XY,Li H,Song JH,Liu JY
    A Dual-Function Transcription Factor, AtYY1, Is a Novel Negative Regulator of the Arabidopsis ABA Response Network.
    Mol Plant, 2016. 9(5): p. 650-661
    [PMID:26961720]