![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Traes_1BS_05948C723.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 76aa MW: 8294.4 Da PI: 10.6176 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 62 | 6.7e-20 | 11 | 55 | 3 | 47 |
--SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEE CS
SRF-TF 3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgkly 47
+e+ rqvtfskR+ g+ KKA+EL vLC a av++fs+ gk +
Traes_1BS_05948C723.1 11 VEDRESRQVTFSKRKSGLWKKASELAVLCRASLAVVVFSEAGKGF 55
588999***********************************9855 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00432 | 2.2E-23 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 23.478 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 1.11E-22 | 2 | 66 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 8.6E-18 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 4.8E-22 | 11 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 8.6E-18 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 8.6E-18 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 76 aa Download sequence Send to blast |
KGRQRRENRL VEDRESRQVT FSKRKSGLWK KASELAVLCR ASLAVVVFSE AGKGFAFGSP 60 STDAVLGYAG YGEANV |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020187835.1 | 2e-41 | uncharacterized protein LOC109773555 | ||||
| Swissprot | O64703 | 9e-20 | AGL29_ARATH; Agamous-like MADS-box protein AGL29 | ||||
| TrEMBL | A0A3B5YTG4 | 5e-46 | A0A3B5YTG4_WHEAT; Uncharacterized protein | ||||
| TrEMBL | A0A446JK89 | 5e-46 | A0A446JK89_TRITD; Uncharacterized protein | ||||
| STRING | Traes_1BS_05948C723.1 | 1e-47 | (Triticum aestivum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP2833 | 30 | 88 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G34440.1 | 4e-22 | AGAMOUS-like 29 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




