![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Traes_1BS_060C24872.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 113aa MW: 13008.8 Da PI: 9.9686 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 53.1 | 7.5e-17 | 2 | 43 | 5 | 48 |
-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
T+ E+ l++++++++G++ W++Iar+++ gRt++++k++w++++
Traes_1BS_060C24872.1 2 TPHEERLILELHARWGNR-WSRIARKLP-GRTDNEIKNYWRTHM 43
9*****************.*********.************986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| CDD | cd00167 | 4.42E-12 | 1 | 43 | No hit | No description |
| PROSITE profile | PS51294 | 24.155 | 1 | 47 | IPR017930 | Myb domain |
| SMART | SM00717 | 2.3E-11 | 1 | 45 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 2.26E-13 | 2 | 50 | IPR009057 | Homeodomain-like |
| Gene3D | G3DSA:1.10.10.60 | 1.8E-20 | 2 | 44 | IPR009057 | Homeodomain-like |
| Pfam | PF00249 | 1.4E-14 | 2 | 42 | IPR001005 | SANT/Myb domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 113 aa Download sequence Send to blast |
MTPHEERLIL ELHARWGNRW SRIARKLPGR TDNEIKNYWR THMRKKAQER KRSVSPSPSS 60 SSVTYQSIQP QTPSIMGIGE QELHGGSSCI TSILKGTPAD MDGYLMDQIW MEI |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. {ECO:0000305}. | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT009536 | 0.0 | BT009536.1 Triticum aestivum clone wr1.pk0139.g11:fis, full insert mRNA sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020201689.1 | 5e-77 | myb-related protein MYBAS2-like isoform X3 | ||||
| Refseq | XP_020201690.1 | 5e-77 | myb-related protein MYBAS2-like isoform X3 | ||||
| Swissprot | Q4JL76 | 6e-55 | MYBA2_ORYSJ; Myb-related protein MYBAS2 | ||||
| TrEMBL | A0A3B6KCK9 | 2e-76 | A0A3B6KCK9_WHEAT; Uncharacterized protein | ||||
| TrEMBL | A0A3B6KDU0 | 3e-76 | A0A3B6KDU0_WHEAT; Uncharacterized protein | ||||
| TrEMBL | A0A446SS17 | 3e-76 | A0A446SS17_TRITD; Uncharacterized protein | ||||
| TrEMBL | A0A446SS82 | 2e-76 | A0A446SS82_TRITD; Uncharacterized protein | ||||
| TrEMBL | A0A446SS86 | 5e-76 | A0A446SS86_TRITD; Uncharacterized protein | ||||
| STRING | Traes_1BS_060C24872.1 | 6e-79 | (Triticum aestivum) | ||||
| STRING | Traes_5AS_7D519210E.2 | 2e-77 | (Triticum aestivum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP636 | 37 | 169 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G59780.1 | 2e-31 | myb domain protein 59 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




