![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Traes_1BS_1202C8C0D.2 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 150aa MW: 16579.5 Da PI: 10.3884 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 98.9 | 2e-31 | 93 | 143 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fs +g+lyeys+
Traes_1BS_1202C8C0D.2 93 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSGRGRLYEYSN 143
79***********************************************95 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 33.403 | 85 | 145 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 7.1E-41 | 85 | 144 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 4.19E-29 | 86 | 145 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 1.45E-38 | 86 | 144 | No hit | No description |
| PRINTS | PR00404 | 1.2E-32 | 87 | 107 | IPR002100 | Transcription factor, MADS-box |
| PROSITE pattern | PS00350 | 0 | 87 | 141 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 8.1E-27 | 94 | 141 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.2E-32 | 107 | 122 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.2E-32 | 122 | 143 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 150 aa Download sequence Send to blast |
MATTGWGNSR YARRGGDSAR GSGAYSLRKP QRERHHQGEE MDHSLSFPSY LQRRVQEVAA 60 QENPVKESAS PGSGSGSPGG AAEKMGRGRI EIKRIENTTN RQVTFCKRRN GLLKKAYELS 120 VLCDAEVALI VFSGRGRLYE YSNNRCSPLS |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1tqe_P | 2e-20 | 85 | 144 | 1 | 60 | Myocyte-specific enhancer factor 2B |
| 1tqe_Q | 2e-20 | 85 | 144 | 1 | 60 | Myocyte-specific enhancer factor 2B |
| 1tqe_R | 2e-20 | 85 | 144 | 1 | 60 | Myocyte-specific enhancer factor 2B |
| 1tqe_S | 2e-20 | 85 | 144 | 1 | 60 | Myocyte-specific enhancer factor 2B |
| 5f28_A | 3e-20 | 85 | 142 | 1 | 58 | MEF2C |
| 5f28_B | 3e-20 | 85 | 142 | 1 | 58 | MEF2C |
| 5f28_C | 3e-20 | 85 | 142 | 1 | 58 | MEF2C |
| 5f28_D | 3e-20 | 85 | 142 | 1 | 58 | MEF2C |
| 6c9l_A | 2e-20 | 85 | 144 | 1 | 60 | Myocyte-specific enhancer factor 2B |
| 6c9l_B | 2e-20 | 85 | 144 | 1 | 60 | Myocyte-specific enhancer factor 2B |
| 6c9l_C | 2e-20 | 85 | 144 | 1 | 60 | Myocyte-specific enhancer factor 2B |
| 6c9l_D | 2e-20 | 85 | 144 | 1 | 60 | Myocyte-specific enhancer factor 2B |
| 6c9l_E | 2e-20 | 85 | 144 | 1 | 60 | Myocyte-specific enhancer factor 2B |
| 6c9l_F | 2e-20 | 85 | 144 | 1 | 60 | Myocyte-specific enhancer factor 2B |
| Search in ModeBase | ||||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AB084577 | 1e-133 | AB084577.1 Triticum aestivum WAG mRNA for MADS box transcription factor, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010230317.1 | 2e-65 | MADS-box transcription factor 58-like isoform X3 | ||||
| TrEMBL | A0A446JQM1 | 1e-106 | A0A446JQM1_TRITD; Uncharacterized protein | ||||
| STRING | Traes_1BS_1202C8C0D.2 | 1e-107 | (Triticum aestivum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP129 | 38 | 398 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G58780.2 | 6e-37 | MIKC_MADS family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




