PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Traes_1BS_A44C97E0F.2

Common Name

Wlip19b

Organism

Triticum aestivum

Taxonomic ID

4565

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum

Family

bZIP

Protein Properties

Length: 150aa MW: 16206.2 Da PI: 9.9975

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Traes_1BS_A44C97E0F.2	genome	IWGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	44.8	2.8e-14	28	86	5	63
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 ++ +r+ +NRe+ArrsR+RK++++eeL ++ L+aeN + ++ ++ e k++ e+ Traes_1BS_A44C97E0F.2 28 RKRKRMLSNRESARRSRARKQQRMEELIAEASRLQAENARVEAQIGAYTTELTKVDGEN 86 57899****************************************99999998887765 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00338	1.7E-19	24	88	IPR004827	Basic-leucine zipper domain
Gene3D	G3DSA:1.20.5.170	8.4E-13	25	82	No hit	No description
Pfam	PF07716	1.1E-10	26	78	IPR004827	Basic-leucine zipper domain
PROSITE profile	PS50217	11.496	26	89	IPR004827	Basic-leucine zipper domain
SuperFamily	SSF57959	2.19E-11	28	81	No hit	No description
PROSITE pattern	PS00036	0	31	46	IPR004827	Basic-leucine zipper domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 150 aa Download sequence Send to blast
MSSPSRRSSS PESNIDGGSG SGSAGDERKR KRMLSNRESA RRSRARKQQR MEELIAEASR 60 LQAENARVEA QIGAYTTELT KVDGENAVLR ARHGELAGRL QALGGVLEIF HVAGAPVDIP 120 EIPDPLLRPW QSPFAPQLAA AGGMPDAFQF

Nucleic Localization Signal ? help Back to Top

No.	Start	End	Sequence
1	40	47	RRSRARKQ

Functional Description ? help Back to Top
Source	Description
UniProt	May contribute to developmentally specific patterns of gene expression. Binds specifically to ocs elements which are transcriptional enhancer found in the promoters of several plant genes. OCSBF-1 is able to bind to a site within each half of the ocs element as well as to animal AP-1 and CREB sites.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AB334126	0.0	AB334126.1 Triticum aestivum Wlip19b mRNA for basic region/leucine zipper protein, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020158427.1	1e-101	ocs element-binding factor 1-like
Swissprot	P24068	1e-32	OCS1_MAIZE; Ocs element-binding factor 1
TrEMBL	A0A446JL62	1e-103	A0A446JL62_TRITD; Uncharacterized protein
TrEMBL	A9ZPJ0	1e-103	A9ZPJ0_WHEAT; Basic region/leucine zipper protein
STRING	Traes_1BS_A44C97E0F.2	1e-103	(Triticum aestivum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP1886	35	100

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G62420.1	3e-23	basic region/leucine zipper motif 53

Publications ? help Back to Top
Kobayashi F, et al. Development of abiotic stress tolerance via bZIP-type transcription factor LIP19 in common wheat. J. Exp. Bot., 2008. 59(4): p. 891-905 [PMID:18326864] Singh K, et al. OCSBF-1, a maize ocs enhancer binding factor: isolation and expression during development. Plant Cell, 1990. 2(9): p. 891-903 [PMID:2152133] Brenchley R, et al. Analysis of the bread wheat genome using whole-genome shotgun sequencing. Nature, 2012. 491(7426): p. 705-10 [PMID:23192148]