PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Traes_1BS_C5E6FB087.1

Organism

Triticum aestivum

Taxonomic ID

4565

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum

Family

TALE

Protein Properties

Length: 153aa MW: 17477.7 Da PI: 7.4414

Description

TALE family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Traes_1BS_C5E6FB087.1	genome	IWGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Homeobox	31.6	2.9e-10	85	117	23	55
SS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS Homeobox 23 rypsaeereeLAkklgLterqVkvWFqNrRake 55 +yp++e++ +LA+ +gL+ rq+ +WF N+R ++ Traes_1BS_C5E6FB087.1 85 PYPTEEDKVRLAAMTGLDPRQINNWFVNQRKRH 117 8*****************************885 PP
2	ELK	35.8	1.8e-12	37	58	1	22
ELK 1 ELKhqLlrKYsgyLgsLkqEFs 22 EL+++Ll+KYsg+L+ L++EF+ Traes_1BS_C5E6FB087.1 37 ELREMLLNKYSGCLSHLRTEFL 58 9********************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM01188	3.5E-6	37	58	IPR005539	ELK domain
PROSITE profile	PS51213	10.039	37	57	IPR005539	ELK domain
Pfam	PF03789	3.2E-9	37	58	IPR005539	ELK domain
PROSITE profile	PS50071	12.39	57	120	IPR001356	Homeobox domain
SuperFamily	SSF46689	4.19E-20	59	126	IPR009057	Homeodomain-like
SMART	SM00389	2.9E-13	59	124	IPR001356	Homeobox domain
Gene3D	G3DSA:1.10.10.60	6.6E-26	62	122	IPR009057	Homeodomain-like
CDD	cd00086	1.45E-11	69	121	No hit	No description
Pfam	PF05920	1.3E-16	77	116	IPR008422	Homeobox KN domain
PROSITE pattern	PS00027	0	95	118	IPR017970	Homeobox, conserved site

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 153 aa Download sequence Send to blast
MMQDEMVESS EDEPCSGDTG ASDAGMQEQS SRLANRELRE MLLNKYSGCL SHLRTEFLKK 60 RKKGKLPKDA RLALIDWWNT HYRWPYPTEE DKVRLAAMTG LDPRQINNWF VNQRKRHWKP 120 SEDMRFALTE GVAGGEGGSS SSTALCFGTD SMR

Nucleic Localization Signal ? help Back to Top

No.	Start	End	Sequence
1	52	61	LRTEFLKKRK
2	58	62	KKRKK

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor that may be involved in shoot formation during embryogenesis. {ECO:0000269\|PubMed:10080693}.
UniProt	Probable transcription factor that may be involved in shoot formation during embryogenesis. {ECO:0000269\|PubMed:10080693, ECO:0000269\|PubMed:10488233}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020158428.1	8e-87	homeobox protein knotted-1-like 10
Swissprot	A2Y007	2e-72	KNOSA_ORYSI; Homeobox protein knotted-1-like 10
Swissprot	Q7GDL5	2e-72	KNOSA_ORYSJ; Homeobox protein knotted-1-like 10
TrEMBL	A0A446JL27	1e-110	A0A446JL27_TRITD; Uncharacterized protein
STRING	Traes_1BS_C5E6FB087.1	1e-112	(Triticum aestivum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP1698	38	92

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G23380.2	6e-38	KNOTTED1-like homeobox gene 6

Publications ? help Back to Top
Ito Y,Eiguchi M,Kurata N KNOX homeobox genes are sufficient in maintaining cultured cells in an undifferentiated state in rice. Genesis, 2001. 30(4): p. 231-8 [PMID:11536429] Postma-Haarsma AD, et al. Developmental regulation and downstream effects of the knox class homeobox genes Oskn2 and Oskn3 from rice. Plant Mol. Biol., 2002. 48(4): p. 423-41 [PMID:11908517] Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Kuijt SJ, et al. Different subcellular localization and trafficking properties of KNOX class 1 homeodomain proteins from rice. Plant Mol. Biol., 2004. 55(6): p. 781-96 [PMID:15604716] Cheng CH, et al. A fine physical map of the rice chromosome 5. Mol. Genet. Genomics, 2005. 274(4): p. 337-45 [PMID:16261349] Brenchley R, et al. Analysis of the bread wheat genome using whole-genome shotgun sequencing. Nature, 2012. 491(7426): p. 705-10 [PMID:23192148] Chu H, et al. A CLE-WOX signalling module regulates root meristem maintenance and vascular tissue development in rice. J. Exp. Bot., 2013. 64(17): p. 5359-69 [PMID:24043854] Kuijt SJ, et al. Interaction between the GROWTH-REGULATING FACTOR and KNOTTED1-LIKE HOMEOBOX families of transcription factors. Plant Physiol., 2014. 164(4): p. 1952-66 [PMID:24532604] Coudert Y, et al. Identification of CROWN ROOTLESS1-regulated genes in rice reveals specific and conserved elements of postembryonic root formation. New Phytol., 2015. 206(1): p. 243-54 [PMID:25442012] Xu Y, et al. OsARID3, an AT-rich Interaction Domain-containing protein, is required for shoot meristem development in rice. Plant J., 2015. 83(5): p. 806-17 [PMID:26121094] Kir G, et al. RNA Interference Knockdown of BRASSINOSTEROID INSENSITIVE1 in Maize Reveals Novel Functions for Brassinosteroid Signaling in Controlling Plant Architecture. Plant Physiol., 2015. 169(1): p. 826-39 [PMID:26162429]