![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Traes_1DL_6DA0DFC5B.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | MIKC_MADS | ||||||||
| Protein Properties | Length: 157aa MW: 17841.5 Da PI: 10.493 | ||||||||
| Description | MIKC_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 92.6 | 1.8e-29 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
krien++ rqvtf+kRrng+lKKA+ELSvLC+ae+a+i+fs +g+lyey+s
Traes_1DL_6DA0DFC5B.1 9 KRIENTTSRQVTFCKRRNGLLKKAYELSVLCEAEIALIVFSARGRLYEYAS 59
79***********************************************86 PP
| |||||||
| 2 | K-box | 89.1 | 8.1e-30 | 83 | 156 | 9 | 82 |
K-box 9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqk 82
+ + +++ qqe+akL+ +i++Lq+ +R+l+Ge++++L+lkeL++Le++L+k++ +iR+kK+ell+++ie++qk
Traes_1DL_6DA0DFC5B.1 83 IDVNSQQYFQQESAKLRHQIQSLQNANRNLMGESVGNLTLKELKSLENRLDKGIGRIRAKKHELLFAEIEYMQK 156
5667789******************************************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00432 | 7.3E-41 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 33.179 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 9.29E-32 | 2 | 73 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 7.11E-42 | 2 | 71 | No hit | No description |
| PRINTS | PR00404 | 7.8E-32 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 2.6E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 7.8E-32 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 7.8E-32 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF01486 | 1.0E-22 | 85 | 156 | IPR002487 | Transcription factor, K-box |
| PROSITE profile | PS51297 | 12.238 | 88 | 157 | IPR002487 | Transcription factor, K-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 157 aa Download sequence Send to blast |
MGRGKIEIKR IENTTSRQVT FCKRRNGLLK KAYELSVLCE AEIALIVFSA RGRLYEYASN 60 STRTTIDRYK KASASASGSA PAIDVNSQQY FQQESAKLRH QIQSLQNANR NLMGESVGNL 120 TLKELKSLEN RLDKGIGRIR AKKHELLFAE IEYMQKL |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1tqe_P | 1e-20 | 1 | 73 | 1 | 73 | Myocyte-specific enhancer factor 2B |
| 1tqe_Q | 1e-20 | 1 | 73 | 1 | 73 | Myocyte-specific enhancer factor 2B |
| 1tqe_R | 1e-20 | 1 | 73 | 1 | 73 | Myocyte-specific enhancer factor 2B |
| 1tqe_S | 1e-20 | 1 | 73 | 1 | 73 | Myocyte-specific enhancer factor 2B |
| 6c9l_A | 1e-20 | 1 | 73 | 1 | 73 | Myocyte-specific enhancer factor 2B |
| 6c9l_B | 1e-20 | 1 | 73 | 1 | 73 | Myocyte-specific enhancer factor 2B |
| 6c9l_C | 1e-20 | 1 | 73 | 1 | 73 | Myocyte-specific enhancer factor 2B |
| 6c9l_D | 1e-20 | 1 | 73 | 1 | 73 | Myocyte-specific enhancer factor 2B |
| 6c9l_E | 1e-20 | 1 | 73 | 1 | 73 | Myocyte-specific enhancer factor 2B |
| 6c9l_F | 1e-20 | 1 | 73 | 1 | 73 | Myocyte-specific enhancer factor 2B |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor. | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AM502895 | 0.0 | AM502895.1 Triticum aestivum mRNA for MIKC-type MADS-box transcription factor WM27B (WM27B gene). | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020149610.1 | 1e-111 | MADS-box transcription factor 21-like | ||||
| Swissprot | Q8RU31 | 2e-94 | MAD21_ORYSJ; MADS-box transcription factor 21 | ||||
| TrEMBL | A0A3B5Y245 | 1e-110 | A0A3B5Y245_WHEAT; Uncharacterized protein | ||||
| TrEMBL | A0A3B5ZXS0 | 1e-110 | A0A3B5ZXS0_WHEAT; Uncharacterized protein | ||||
| TrEMBL | A0A446J3D7 | 1e-110 | A0A446J3D7_TRITD; Uncharacterized protein | ||||
| TrEMBL | A0A446K1W1 | 1e-110 | A0A446K1W1_TRITD; Uncharacterized protein | ||||
| TrEMBL | A0A452Z5F3 | 1e-110 | A0A452Z5F3_AEGTS; Uncharacterized protein | ||||
| TrEMBL | A9J215 | 1e-110 | A9J215_WHEAT; MIKC-type MADS-box transcription factor WM27A | ||||
| STRING | Traes_1AL_5F5A87122.2 | 1e-111 | (Triticum aestivum) | ||||
| STRING | Traes_1DL_6DA0DFC5B.1 | 1e-111 | (Triticum aestivum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP649 | 37 | 144 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G42830.1 | 1e-75 | MIKC_MADS family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




