PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_1DL_9EFDBD741.1
Organism
Triticum aestivum
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family Trihelix
Protein Properties Length: 74aa    MW: 8810.95 Da    PI: 10.463
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_1DL_9EFDBD741.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix75.49.4e-241691787
               trihelix 17 meerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87
                           m+ ++r++ lk+plWeevs+k++e+g++r++k+Ckek+en++k+yk++k+++ +r  ++ +t+++f+qlea
  Traes_1DL_9EFDBD741.1  1 MDAAFRDATLKGPLWEEVSRKLAEEGYRRNAKKCKEKFENVHKYYKRTKDSRAGR--NDGKTYRFFRQLEA 69
                           6889*************************************************97..56668*******85 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd122031.55E-16149No hitNo description
PfamPF138373.5E-17370No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 74 aa     Download sequence    Send to blast
MDAAFRDATL KGPLWEEVSR KLAEEGYRRN AKKCKEKFEN VHKYYKRTKD SRAGRNDGKT  60
YRFFRQLEAM NSTS
Functional Description ? help Back to Top
Source Description
UniProtTranscription repressor that binds specific DNA sequence such as GT3 box 5'-GGTAAA-3' in the SDD1 promoter. Negative regulator of water use efficiency (WUE) via the promotion of stomatal density and distribution by the transcription repression of SDD1. Regulates the expression of several cell cycle genes and endoreduplication, especially in trichomes where it prevents ploidy-dependent plant cell growth. {ECO:0000269|PubMed:19717615, ECO:0000269|PubMed:21169508}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Down-regulated by water stress. {ECO:0000269|PubMed:21169508}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3544261e-97AK354426.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv1007E05.
GenBankAK3615071e-97AK361507.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv1142F04.
GenBankAK3727131e-97AK372713.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv3010E21.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020191229.13e-45trihelix transcription factor GTL1-like isoform X1
RefseqXP_020191230.11e-45trihelix transcription factor GTL1-like isoform X2
SwissprotQ9C8821e-33GTL1_ARATH; Trihelix transcription factor GTL1
TrEMBLA0A3B5ZT323e-44A0A3B5ZT32_WHEAT; Uncharacterized protein
TrEMBLA0A3B5ZU767e-44A0A3B5ZU76_WHEAT; Uncharacterized protein
TrEMBLA0A452YIW66e-44A0A452YIW6_AEGTS; Uncharacterized protein
TrEMBLA0A452YIW96e-44A0A452YIW9_AEGTS; Uncharacterized protein
TrEMBLA0A452YIX03e-45A0A452YIX0_AEGTS; Uncharacterized protein
STRINGTraes_1DL_9EFDBD741.13e-48(Triticum aestivum)
STRINGTRIUR3_33328-P11e-43(Triticum urartu)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP60638175
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G33240.19e-36GT-2-like 1
Publications ? help Back to Top
  1. Caro E,Desvoyes B,Gutierrez C
    GTL1 keeps cell growth and nuclear ploidy under control.
    EMBO J., 2012. 31(24): p. 4483-5
    [PMID:23188085]
  2. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]
  3. Zheng X, et al.
    The Wheat GT Factor TaGT2L1D Negatively Regulates Drought Tolerance and Plant Development.
    Sci Rep, 2016. 6: p. 27042
    [PMID:27245096]
  4. Shibata M, et al.
    GTL1 and DF1 regulate root hair growth through transcriptional repression of ROOT HAIR DEFECTIVE 6-LIKE 4 in Arabidopsis.
    Development, 2018.
    [PMID:29439132]