PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Traes_1DL_D1EC7DEA6.1

Organism

Triticum aestivum

Taxonomic ID

4565

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum

Family

WRKY

Protein Properties

Length: 112aa MW: 12605.9 Da PI: 9.7148

Description

WRKY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Traes_1DL_D1EC7DEA6.1	genome	IWGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRKY	83.8	1.7e-26	65	111	1	47
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTE CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkv 47 ldDgy+WrKYGqK vk+s fprsYYrCt a+C vkk vers++dp++ Traes_1DL_D1EC7DEA6.1 65 LDDGYRWRKYGQKAVKNSSFPRSYYRCTVARCGVKKLVERSQQDPST 111 59******************************************987 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:2.20.25.80	3.8E-26	51	112	IPR003657	WRKY domain
SuperFamily	SSF118290	7.72E-23	58	111	IPR003657	WRKY domain
PROSITE profile	PS50811	23.273	60	112	IPR003657	WRKY domain
SMART	SM00774	4.5E-21	65	112	IPR003657	WRKY domain
Pfam	PF03106	5.4E-20	66	111	IPR003657	WRKY domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 112 aa Download sequence Send to blast
GEAAGVESHG CKRGSPVPEE GDEDGSADHH NHRSDEKEQK KKGKWEKKAR GSRVAFATKS 60 EVDHLDDGYR WRKYGQKAVK NSSFPRSYYR CTVARCGVKK LVERSQQDPS TV

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1wj2_A	4e-21	58	112	10	64	Probable WRKY transcription factor 4
2lex_A	4e-21	58	112	10	64	Probable WRKY transcription factor 4
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KR827397	1e-138	KR827397.1 Triticum aestivum WRKY46 transcriptional factor mRNA, partial cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020180590.1	2e-75	probable WRKY transcription factor 71 isoform X2
Swissprot	O22900	1e-31	WRK23_ARATH; WRKY transcription factor 23
TrEMBL	A0A3B6A1S2	9e-75	A0A3B6A1S2_WHEAT; Uncharacterized protein
STRING	EMT31777	6e-75	(Aegilops tauschii)
STRING	Traes_1DL_D1EC7DEA6.1	7e-77	(Triticum aestivum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP623	37	173

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G47260.1	3e-32	WRKY DNA-binding protein 23

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Brenchley R, et al. Analysis of the bread wheat genome using whole-genome shotgun sequencing. Nature, 2012. 491(7426): p. 705-10 [PMID:23192148] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Guo D,Qin G EXB1/WRKY71 transcription factor regulates both shoot branching and responses to abiotic stresses. Plant Signal Behav, 2016. 11(3): p. e1150404 [PMID:26914912] Prát T, et al. WRKY23 is a component of the transcriptional network mediating auxin feedback on PIN polarity. PLoS Genet., 2018. 14(1): p. e1007177 [PMID:29377885]