![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Traes_1DL_D550418641.2 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | WRKY | ||||||||
| Protein Properties | Length: 96aa MW: 11367.7 Da PI: 9.4278 | ||||||||
| Description | WRKY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | WRKY | 99.2 | 2.5e-31 | 10 | 68 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
ldDgy+WrKYG+K+vk+s++pr+YYrC+++gC+vkk+ver+++dp +v++tYeg+H h
Traes_1DL_D550418641.2 10 LDDGYKWRKYGKKSVKNSPNPRNYYRCSTEGCSVKKRVERDRDDPAYVVTTYEGTHSHX 68
59********************************************************6 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:2.20.25.80 | 1.2E-31 | 2 | 68 | IPR003657 | WRKY domain |
| SuperFamily | SSF118290 | 3.4E-28 | 2 | 68 | IPR003657 | WRKY domain |
| PROSITE profile | PS50811 | 30.056 | 5 | 70 | IPR003657 | WRKY domain |
| SMART | SM00774 | 2.8E-34 | 10 | 69 | IPR003657 | WRKY domain |
| Pfam | PF03106 | 3.6E-25 | 11 | 67 | IPR003657 | WRKY domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 96 aa Download sequence Send to blast |
FRTRTEIEIL DDGYKWRKYG KKSVKNSPNP RNYYRCSTEG CSVKKRVERD RDDPAYVVTT 60 YEGTHSHXXX XXXXXXXXXX XXXXXXXXXX XAHSTE |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1wj2_A | 1e-25 | 1 | 67 | 8 | 74 | Probable WRKY transcription factor 4 |
| 2lex_A | 1e-25 | 1 | 67 | 8 | 74 | Probable WRKY transcription factor 4 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | KR827402 | 1e-109 | KR827402.1 Triticum aestivum WRKY51 transcriptional factor mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020147509.1 | 1e-44 | probable WRKY transcription factor 57 | ||||
| Swissprot | Q8VWQ5 | 7e-37 | WRK50_ARATH; Probable WRKY transcription factor 50 | ||||
| TrEMBL | M8BCQ2 | 1e-43 | M8BCQ2_AEGTA; Uncharacterized protein | ||||
| STRING | EMT22670 | 2e-44 | (Aegilops tauschii) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP441 | 37 | 206 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G26170.1 | 3e-39 | WRKY DNA-binding protein 50 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




