PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Traes_1DL_D79FDE483.1

Organism

Triticum aestivum

Taxonomic ID

4565

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum

Family

NAC

Protein Properties

Length: 65aa MW: 8128.41 Da PI: 5.8642

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Traes_1DL_D79FDE483.1	genome	IWGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	71.3	2.4e-22	2	65	3	67
NAM 3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkk 67 pGfrFhPt+eel+ +yL++kveg+++++ e i+ +d+y+++Pw+Lp+++ +ekew+f+++rd+k Traes_1DL_D79FDE483.1 2 PGFRFHPTEEELIEFYLRRKVEGRRFNV-ELITFLDLYRFDPWELPAMAVIGEKEWFFYVPRDRK 65 9*************************.89***********7777899*******986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51005	25.826	1	65	IPR003441	NAC domain
Pfam	PF02365	5.3E-11	2	63	IPR003441	NAC domain
SuperFamily	SSF101941	3.01E-24	2	65	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 65 aa Download sequence Send to blast
MPGFRFHPTE EELIEFYLRR KVEGRRFNVE LITFLDLYRF DPWELPAMAV IGEKEWFFYV 60 PRDRK

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3ulx_A	2e-23	2	65	17	80	Stress-induced transcription factor NAC1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that acts as a floral repressor. Controls flowering time by negatively regulating CONSTANS (CO) expression in a GIGANTEA (GI)-independent manner. Regulates the plant cold response by positive regulation of the cold response genes COR15A and KIN1. May coordinate cold response and flowering time. {ECO:0000269\|PubMed:17653269}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Circadian regulation with a peak of expression at dawn under continuous light conditions (PubMed:17653269). Circadian regulation with a peak of expression around dusk and lowest expression around dawn under continuous light conditions (at protein level) (PubMed:17653269). {ECO:0000269\|PubMed:17653269}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK102902	3e-73	AK102902.1 Oryza sativa Japonica Group cDNA clone:J033113D13, full insert sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_015637953.1	7e-44	NAC domain-containing protein 35
Swissprot	Q9ZVP8	2e-41	NAC35_ARATH; NAC domain-containing protein 35
TrEMBL	A0A0D9ZZ99	1e-42	A0A0D9ZZ99_9ORYZ; Uncharacterized protein
TrEMBL	A0A0E0DRG7	1e-42	A0A0E0DRG7_9ORYZ; Uncharacterized protein
TrEMBL	A0A0E0HEK3	2e-42	A0A0E0HEK3_ORYNI; Uncharacterized protein
TrEMBL	A0A0E0PML5	1e-42	A0A0E0PML5_ORYRU; Uncharacterized protein
TrEMBL	A2Y4R5	2e-42	A2Y4R5_ORYSI; Uncharacterized protein
TrEMBL	I1PVQ1	1e-42	I1PVQ1_ORYGL; Uncharacterized protein
TrEMBL	Q0DI41	2e-42	Q0DI41_ORYSJ; Os05g0418800 protein
STRING	OGLUM05G17770.1	2e-43	(Oryza glumipatula)
STRING	OMERI05G13800.1	3e-43	(Oryza meridionalis)
STRING	ORUFI05G17970.1	2e-43	(Oryza rufipogon)
STRING	ONIVA05G17420.1	3e-43	(Oryza nivara)
STRING	ORGLA05G0144900.1	2e-43	(Oryza glaberrima)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP29571	2	2

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G02450.2	9e-44	NAC domain containing protein 35

Publications ? help Back to Top
Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Okajima K Molecular mechanism of phototropin light signaling. J. Plant Res., 2016. 129(2): p. 149-57 [PMID:26815763] Nakasone Y,Ohshima M,Okajima K,Tokutomi S,Terazima M Photoreaction Dynamics of LOV1 and LOV2 of Phototropin from Chlamydomonas reinhardtii. J Phys Chem B, 2018. 122(6): p. 1801-1815 [PMID:29355019]