![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Traes_1DL_EDA7A1267.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 88aa MW: 9875.1 Da PI: 8.551 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 52.9 | 8.4e-17 | 3 | 46 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
rg+++++E++ ++ +++ lG++ W+ Ia++++ gRt++++k++w++
Traes_1DL_EDA7A1267.1 3 RGSFSQQEEDHIIALHQILGNR-WSQIASHLP-GRTDNEIKNFWNS 46
89********************.*********.***********96 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 24.681 | 1 | 52 | IPR017930 | Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 1.7E-22 | 1 | 52 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 9.0E-14 | 2 | 50 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 4.37E-15 | 3 | 58 | IPR009057 | Homeodomain-like |
| Pfam | PF00249 | 3.5E-15 | 3 | 46 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 8.22E-11 | 5 | 45 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 88 aa Download sequence Send to blast |
LRRGSFSQQE EDHIIALHQI LGNRWSQIAS HLPGRTDNEI KNFWNSCIKK KLRQQSIDPA 60 THKPMGATAT AALPDAEEED RKTLSAAV |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1a5j_A | 4e-14 | 1 | 52 | 57 | 108 | B-MYB |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Possible transcription activator in response to an external signal. May be involved in the regulation of flavonoid biosynthesis. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK364378 | 1e-88 | AK364378.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2024H18. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020158685.1 | 5e-58 | myb-related protein Hv33-like | ||||
| Swissprot | P20027 | 4e-42 | MYB3_HORVU; Myb-related protein Hv33 | ||||
| TrEMBL | A0A3B6A1L2 | 1e-56 | A0A3B6A1L2_WHEAT; Uncharacterized protein | ||||
| TrEMBL | A0A452ZQS7 | 1e-56 | A0A452ZQS7_AEGTS; Uncharacterized protein | ||||
| STRING | Traes_1DL_EDA7A1267.1 | 8e-60 | (Triticum aestivum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP2327 | 33 | 91 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G26660.1 | 2e-32 | myb domain protein 86 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




