![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Traes_1DS_AAEBFA9CC.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | HB-other | ||||||||
| Protein Properties | Length: 73aa MW: 8169.1 Da PI: 11.0141 | ||||||||
| Description | HB-other family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Homeobox | 51 | 2.4e-16 | 11 | 55 | 12 | 56 |
HHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
Homeobox 12 leeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
+ +Le++F+++++p++++ + L++++g+t +q+k+WFq rRa+ k
Traes_1DS_AAEBFA9CC.1 11 ILALEAAFKQCPHPDETQVANLSRETGMTPQQIKYWFQTRRAQIK 55
789***************************************977 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00389 | 3.4E-11 | 5 | 61 | IPR001356 | Homeobox domain |
| SuperFamily | SSF46689 | 2.61E-15 | 10 | 68 | IPR009057 | Homeodomain-like |
| Gene3D | G3DSA:1.10.10.60 | 4.7E-15 | 11 | 55 | IPR009057 | Homeodomain-like |
| Pfam | PF00046 | 9.9E-14 | 11 | 55 | IPR001356 | Homeobox domain |
| CDD | cd00086 | 5.89E-13 | 11 | 55 | No hit | No description |
| PROSITE profile | PS50071 | 12.714 | 14 | 57 | IPR001356 | Homeobox domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 73 aa Download sequence Send to blast |
MDGHRRGARR ILALEAAFKQ CPHPDETQVA NLSRETGMTP QQIKYWFQTR RAQIKGSSSN 60 TRPPTQGSSS SDP |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor. {ECO:0000250}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010268321.1 | 2e-16 | PREDICTED: homeobox-leucine zipper protein HDG11-like isoform X1 | ||||
| Refseq | XP_010268322.1 | 2e-16 | PREDICTED: homeobox-leucine zipper protein HDG11-like isoform X2 | ||||
| Swissprot | Q69T58 | 8e-17 | ROC8_ORYSJ; Homeobox-leucine zipper protein ROC8 | ||||
| TrEMBL | A0A452XN11 | 3e-46 | A0A452XN11_AEGTS; Uncharacterized protein | ||||
| STRING | Traes_1DS_AAEBFA9CC.1 | 3e-48 | (Triticum aestivum) | ||||
| STRING | Traes_2AL_AAEBFA9CC.1 | 3e-48 | (Triticum aestivum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP25104 | 2 | 5 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G73360.1 | 2e-18 | homeodomain GLABROUS 11 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




