![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Traes_1DS_C1D7139D7.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 95aa MW: 11202.6 Da PI: 9.2539 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 69 | 8.3e-22 | 47 | 94 | 44 | 93 |
NF-YB 44 sfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrel 93
f++sea dkcqrekrk in ddllwa+atlGfe+y+epl yl+kyre+
Traes_1DS_C1D7139D7.1 47 CFIASEARDKCQREKRKIINVDDLLWAMATLGFEEYIEPL--YLQKYREI 94
69*************************************8..9*****97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 1.2E-17 | 48 | 93 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 7.9E-6 | 48 | 74 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| SuperFamily | SSF47113 | 6.16E-13 | 48 | 93 | IPR009072 | Histone-fold |
| PRINTS | PR00615 | 9.9E-5 | 57 | 75 | No hit | No description |
| PRINTS | PR00615 | 9.9E-5 | 76 | 94 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 95 aa Download sequence Send to blast |
LRQRQGAGQV PTHRQHRQHH EEGHPGQRQD RQGRQGDLAG VRLGVHCFIA SEARDKCQRE 60 KRKIINVDDL LWAMATLGFE EYIEPLYLQK YREIF |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1n1j_A | 6e-15 | 48 | 93 | 46 | 93 | NF-YB |
| 4awl_B | 5e-15 | 48 | 93 | 47 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| 4csr_A | 5e-15 | 48 | 93 | 47 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT009078 | 1e-102 | BT009078.1 Triticum aestivum clone wkm1c.pk0002.d7:fis, full insert mRNA sequence. | |||
| GenBank | KM078735 | 1e-102 | KM078735.1 Triticum aestivum CCAAT-binding transcription factor A (NFYB-A2) mRNA, complete cds. | |||
| GenBank | KM078736 | 1e-102 | KM078736.1 Triticum aestivum CCAAT-binding transcription factor A (NFYB-B2) mRNA, complete cds. | |||
| GenBank | KM078737 | 1e-102 | KM078737.1 Triticum aestivum CCAAT-binding transcription factor A (NFYB-D2) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Swissprot | P25209 | 5e-22 | NFYB_MAIZE; Nuclear transcription factor Y subunit B | ||||
| TrEMBL | A0A3B6LU14 | 1e-24 | A0A3B6LU14_WHEAT; Uncharacterized protein | ||||
| STRING | Traes_1DS_C1D7139D7.1 | 3e-64 | (Triticum aestivum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP201 | 38 | 331 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G14540.1 | 2e-23 | nuclear factor Y, subunit B3 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




