![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Traes_2AL_D3B2C21A7.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | HSF | ||||||||
| Protein Properties | Length: 88aa MW: 9899.11 Da PI: 9.0995 | ||||||||
| Description | HSF family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | HSF_DNA-bind | 82.8 | 5e-26 | 13 | 71 | 2 | 60 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS
HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60
Fl+k+y +++d+e++++isw+e+g++fvv+ + ef++++Lpk FkhsnfaSFvRQLn+Y
Traes_2AL_D3B2C21A7.1 13 FLTKTYAMVDDPETDDTISWNESGTAFVVWRRAEFERDLLPKNFKHSNFASFVRQLNTY 71
9********************************************************** PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.10 | 2.4E-27 | 8 | 72 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| SMART | SM00415 | 4.0E-21 | 9 | 87 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| SuperFamily | SSF46785 | 4.62E-23 | 11 | 71 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| PRINTS | PR00056 | 5.6E-15 | 13 | 36 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Pfam | PF00447 | 1.0E-21 | 13 | 71 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 5.6E-15 | 51 | 63 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 5.6E-15 | 64 | 76 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 88 aa Download sequence Send to blast |
MASPALGAGT PPFLTKTYAM VDDPETDDTI SWNESGTAFV VWRRAEFERD LLPKNFKHSN 60 FASFVRQLNT YVRSVSARPP LSGWFGRS |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1hks_A | 1e-19 | 7 | 71 | 1 | 65 | HEAT-SHOCK TRANSCRIPTION FACTOR |
| 1hkt_A | 1e-19 | 7 | 71 | 1 | 65 | HEAT-SHOCK TRANSCRIPTION FACTOR |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional regulator that specifically binds DNA of heat shock promoter elements (HSE). {ECO:0000250}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | EU953624 | 1e-116 | EU953624.1 Zea mays clone 1440437 heat shock factor protein 4 mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020152813.1 | 1e-45 | heat stress transcription factor B-2a-like | ||||
| Swissprot | Q7XRX3 | 2e-36 | HFB2A_ORYSJ; Heat stress transcription factor B-2a | ||||
| TrEMBL | A0A446LBY4 | 2e-57 | A0A446LBY4_TRITD; Uncharacterized protein | ||||
| STRING | Traes_2AL_D3B2C21A7.1 | 4e-59 | (Triticum aestivum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP121 | 37 | 394 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G36990.1 | 4e-29 | heat shock factor 4 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




