PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Traes_2AL_E93926EE7.1

Organism

Triticum aestivum

Taxonomic ID

4565

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum

Family

Dof

Protein Properties

Length: 73aa MW: 8075.03 Da PI: 9.3473

Description

Dof family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Traes_2AL_E93926EE7.1	genome	IWGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	zf-Dof	62.5	7.6e-20	37	73	2	38
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrr 38 ++++l+cprC s++tkfCyynnys++qPr++C++Crr Traes_2AL_E93926EE7.1 37 QQQKLECPRCSSSDTKFCYYNNYSTAQPRHYCRTCRR 73 6899********************************9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD007478	3.0E-12	20	73	IPR003851	Zinc finger, Dof-type
Pfam	PF02701	2.8E-17	39	73	IPR003851	Zinc finger, Dof-type
PROSITE profile	PS50884	19.097	41	73	IPR003851	Zinc finger, Dof-type

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 73 aa Download sequence Send to blast
MAPASASLLA GAKRSADATE LPQAQEGALT KKNGQSQQQK LECPRCSSSD TKFCYYNNYS 60 TAQPRHYCRT CRR

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK375024	3e-61	AK375024.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3083K20.
GenBank	AK375174	3e-61	AK375174.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3087B14.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020148958.1	2e-38	dof zinc finger protein DOF5.6-like
TrEMBL	A0A3B6B9S6	8e-45	A0A3B6B9S6_WHEAT; Uncharacterized protein
STRING	Traes_2AL_E93926EE7.1	1e-46	(Triticum aestivum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP14047	24	27

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G66940.1	2e-18	Dof family protein

Publications ? help Back to Top
Brenchley R, et al. Analysis of the bread wheat genome using whole-genome shotgun sequencing. Nature, 2012. 491(7426): p. 705-10 [PMID:23192148]