![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Traes_2AS_455BD2CA1.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
| Family | GRAS | ||||||||
| Protein Properties | Length: 50aa MW: 5665.26 Da PI: 4.3983 | ||||||||
| Description | GRAS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | GRAS | 26.8 | 6e-09 | 2 | 33 | 343 | 374 |
GRAS 343 kvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
+++++gy++ ee+g+l lgWkd +L+++S+W+
Traes_2AS_455BD2CA1.1 2 MYPWKGYTLVEEDGCLKLGWKDLSLLTASSWE 33
5779***************************5 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF03514 | 2.1E-6 | 2 | 33 | IPR005202 | Transcription factor GRAS |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 50 aa Download sequence Send to blast |
GMYPWKGYTL VEEDGCLKLG WKDLSLLTAS SWEPTEDDHA AVAEQKRHDS |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020200232.1 | 4e-27 | scarecrow-like protein 23 isoform X1 | ||||
| Refseq | XP_020200233.1 | 3e-27 | scarecrow-like protein 23 isoform X2 | ||||
| TrEMBL | A0A3B6AVJ1 | 4e-27 | A0A3B6AVJ1_WHEAT; Uncharacterized protein | ||||
| TrEMBL | A0A446KTW5 | 4e-27 | A0A446KTW5_TRITD; Uncharacterized protein | ||||
| STRING | Traes_2AS_455BD2CA1.1 | 2e-29 | (Triticum aestivum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP52426 | 2 | 2 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G41920.1 | 4e-15 | GRAS family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




